NF-M Antibody

Images

 
Western Blot: NF-M Antibody [NBP1-87753] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
Immunocytochemistry/ Immunofluorescence: NF-M Antibody [NBP1-87753] - Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol.
Immunohistochemistry: NF-M Antibody [NBP1-87753] - Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cell.
Immunocytochemistry/ Immunofluorescence: NF-M Antibody [NBP1-87753] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NF-M Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Marker
Neuronal Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEFM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:2500-1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NF-M Protein (NBP1-87753PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NF-M Antibody

  • NEF3
  • NEF3neurofilament medium polypeptide
  • NEFM
  • Neurofilament 3
  • neurofilament, medium polypeptide 150kDa
  • neurofilament, medium polypeptide
  • neurofilament-3 (150 kD medium)
  • NFM
  • NF-M
  • NF-M160 kDa neurofilament protein
  • NFMNeurofilament triplet M protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-135
Species: Hu, Mu, Rt, Po, Bv, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-140
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-137
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
AF3795
Species: Hu
Applications: WB, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for NF-M Antibody (NBP1-87753) (0)

There are no publications for NF-M Antibody (NBP1-87753).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NF-M Antibody (NBP1-87753) (0)

There are no reviews for NF-M Antibody (NBP1-87753). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NF-M Antibody (NBP1-87753) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NF-M Products

Bioinformatics Tool for NF-M Antibody (NBP1-87753)

Discover related pathways, diseases and genes to NF-M Antibody (NBP1-87753). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF-M Antibody (NBP1-87753)

Discover more about diseases related to NF-M Antibody (NBP1-87753).
 

Pathways for NF-M Antibody (NBP1-87753)

View related products by pathway.

PTMs for NF-M Antibody (NBP1-87753)

Learn more about PTMs related to NF-M Antibody (NBP1-87753).
 

Research Areas for NF-M Antibody (NBP1-87753)

Find related products by research area.

Blogs on NF-M

There are no specific blogs for NF-M, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NF-M Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEFM
Entrez