Home » NF-M » NF-M Antibodies » NF-M Antibody (CL2688)

NF-M Antibody (CL2688)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: NF-M Antibody (2688) [NBP2-46618] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse Cerebral Cortex tissue
Western Blot: NF-M Antibody (2688) [NBP2-46618] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse Cerebral Cortex tissue
Immunohistochemistry: NF-M Antibody (2688) [NBP2-46618] - Staining of human tonsil shows absence of immunoreactivity (negative control).
Western Blot: NF-M Antibody (2688) [NBP2-46618] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: NF-M Antibody (2688) [NBP2-46618] - Staining of rat cerebellum shows strong immunoreactivity in neuronal processes.
Immunohistochemistry: NF-M Antibody (2688) [NBP2-46618] - Staining of mouse trigeminal ganglion shows strong immunoreactivity in ganglion cells.
Immunohistochemistry: NF-M Antibody (2688) [NBP2-46618] - Staining of human cerebellum shows strong immunoreactivity in Purkinje cells and neural fibers.
Immunohistochemistry: NF-M Antibody (2688) [NBP2-46618] - Staining of rat brainstem shows strong positivity in neurons of mesencephalic trigeminal nucleus.
Immunohistochemistry: NF-M Antibody (2688) [NBP2-46618] - Staining of mouse thalamus shows strong positivity in neural fibers.
Immunohistochemistry: NF-M Antibody (2688) [NBP2-46618] - Staining of human cerebral cortex shows strong positivity in neural fibers and cell bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL2688
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NF-M Antibody (CL2688) Summary

Immunogen
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence YIEKVHYLEQQNKEIEAEIQALRQKQASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDIEEASLVKVELDKKVQSLQDEVAFLRSNH
Epitope
LKERFEEEARLRDDT
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
NEFM
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 1 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. It has been reported that the antibody gives weak staining when testing in IHC on frozen tissue sections.
Publications
Read Publication using NBP2-46618.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for NF-M Antibody (CL2688)

  • NEF3
  • NEF3neurofilament medium polypeptide
  • NEFM
  • Neurofilament 3
  • neurofilament, medium polypeptide 150kDa
  • neurofilament, medium polypeptide
  • neurofilament-3 (150 kD medium)
  • NFM
  • NF-M
  • NF-M160 kDa neurofilament protein
  • NFMNeurofilament triplet M protein

Background

Neurofilaments are 10nm intermediate filament proteins located in vertebrate neurons, which regulate axonal diameter. They are composed predominantly of the three major neurofilament proteins: NF-Light, NF-Medium and NF-Heavy. NF-M is the middle or medium neurofilament subunit and runs on SDS-PAGE gels in the range 145-170kDa, with some size variation in across species.

Antibodies to NF-M may be used to identify NF-M in neurons and to study neuronal processes in tissue sections and/or culture. NF-M can also be useful in studies of neurofilament accumulations seen in many neurological diseases, such as Lou Gehrig's disease or Alzheimer's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NF-H Antibody
NB300-135
Immunohistochemistry: NF-H Antibody [NB300-135] - Mouse hippocampus section stained with rabbit pAb to NF-H, dilution 1:2,000 in red, and costained with mouse mAb to myelin basic protein (MBP), dilution 1:5,000 in green. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion with 4% paraformaldehyde, brain was post fixed for 24 hours, cut to 45uM, and free-floating sections were stained with above antibodies. The NF-H antibody labels a network of axons of different neurons, while the MBP antibody stains myelin sheath around these axons.
Western Blot: NF-H Antibody [NB300-135] - Different tissue lysates using rabbit pAb to NF-H, dilution 1:10,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord [4] mouse brain, and [5] mouse spinal cord lysate. Strong band at about 220 kDa corresponds to the phosphorylated axonal form of the NF-H subunit. Smaller proteolytic fragments of NF-H are also detected with RPCA-NF-H antibody.
Western Blot: NF-H Antibody [NB300-135] - Analysis of 200kDa Neurofilament Heavy expression in rat spinal cord extract. The first lane is Coomassie Brilliant Blue stained and the second lane is probed with rabbit anti-Neurofilament Heavy antibody NB300-135. The NF-H corresponds to a weight of 200kDa.
(22 Publications)
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, WB
NF-L Antibody
NB300-131
Immunocytochemistry/Immunofluorescence: NF-L Antibody [NB300-131] - Analysis of mouse cerebellum section stained with rabbit pAb to NF-L, NB300-131, dilution 1:5,000 in red, and costained with chicken pAb to MBP, dilution 1:5,000, in green. Following transcardial perfusion of mouse with 4% paraformaldehyde, brain was post fixed for 24 hours, cut to 45uM, and free-floating sections were stained with above antibodies. NB300-131 antibody labels dendrites and axons of neuronal cells, and MBP antibody stains the network of myelin sheathes around axons.
Western Blot: NF-L Antibody [NB300-131] - Analysis of different tissue lysates using rabbit pAb to NF-L, NB300-131, dilution 1:20,000. in green. [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. The strong band at 68kDa corresponds to the NF-L protein.
Immunocytochemistry/Immunofluorescence: NF-L Antibody [NB300-131] - Neurofilament (NF-L antibody) used as axon marker in WT and KO mice using immunofluorescence staining to illustrate the axon morphology of retinal ganglion cells. Central part of retina is enlarged and displayed in WT and KO mice. Scale bars are 500 micrometers for left and 200 micrometers for right. Citation: Lin Y-S, Kuo K-T, Chen S-K, Huang H-S (2018) RBFOX3/NeuN is dispensable for visual function. PLoS ONE 13(2): e0192355. https://doi.org/10.1371/journal.pone.0192355
(8 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Neurofascin
Antibody
AF3235
Western blot shows lysates of rat brain tissue, mouse brain tissue, and human brain (cerebellum). PVDF Membrane was probed with 0.1 µg/mL of Chicken Anti-Human/Mouse/Rat Neurofascin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3235) followed by HRP-conjugated Anti-Chicken IgY Secondary Antibody. Specific bands were detected for Neurofascin at approximately 140 and186 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Neurofascin was detected in perfusion fixed frozen sections of rat brain (dorsal root ganglion) using Chicken Anti-Human/Mouse/Rat Neurofascin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3235) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Chicken IgY Secondary Antibody (yellow; Catalog # NL016) and counterstained with DAPI (blue). Specific staining was localized to neuronal cell bodies and Schwann cells (perinodal regions). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
GFAP Antibody
NB300-141
Immunohistochemistry: GFAP Antibody [NB300-141] - Analysis of a rat cerebellum section stained with rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green and mouse monoclonal antibody to MeCP2, dilution 1:500, in red. The blue is DAPI staining of nuclear DNA. Following transcardial perfusion of rat with 4% paraformaldehyde, brain was post fixed for 1 hour, cut to 45 uM, and free-floating sections were stained with above antibodies. The GFAP antibody stains the network of astrocytic cells and the processes of Bergmann glia in the molecular layer. The MeCP2 antibody specifically labels nuclei of certain neurons.
Western Blot: GFAP Antibody [NB300-141] - Analysis of different tissue lysates using rabbit polyclonal antibody to GFAP, NB300-141, dilution 1:5000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord. Strong band at about 50 kDa corresponds to the major isotype of the GFAP protein. Smaller isotypes and proteolytic fragments of GFAP are also detected on the blot.
Western Blot: GFAP Antibody [NB300-141] - Analysis of Rat brain lysate. Antibody at 1:5000. Specific band running with an apparent SDS-PAGE molecular weight of ~50 kDa corresponds to rodent GFAP was observed.
(12 Reviews)
(83 Publications)
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Vimentin Antibody
NB300-223
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Analysis of HeLa cell culture. Antibody at 1:10,000 in green, and costained with mouse mAb to actin, dilution 1:500 in red. The blue is DAPI staining of nuclear DNA. The vimentin antibody stains the intermediate filament network while the actin antibody labels the submembranous cytoskeleton, stress fibers, and bundles of actin associated with cell adhesion sites.
Immunohistochemistry-Frozen: Vimentin Antibody [NB300-223] - 10 um Cryosections from PFA fixed murine brain acute slices stained with Vimentin antibody (1:600) and Alexa Fluor 488 anti chicken IgG. Antibody showed specific staining, also of blood vessels. IHC-Fr image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Vimentin Antibody [NB300-223] - Human A7 cells. Cells were fixed with 10% formalin and permeabilized with 0.1% TritonX-100. After blocking, cells were incubated with primary antibody (1:600) at 4C O/N followed with Alexa Fluor 488 labeled secondary antibody and counterstained with DAPI and Phalloidin for nuclei and F-actin respectively. Imaged with Leica TCS SP5 confocal microscope. ICC/IF image submitted by a verified customer review.
(6 Reviews)
(55 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
alpha-Internexin
Antibody (2E3)
NB300-140
Western Blot: alpha-Internexin Antibody (2E3) [NB300-140] - Analysis of different tissue lysates using alpha-Internexin, dilution 1:10000 (Red): [1] protein standard, [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, and [6] cow spinal cord lysate. The antibody reveals the alpha-Internexin protein with an apparent molecular weight of 64-66kDa, with some variability across species.
Immunohistochemistry: alpha-Internexin Antibody (2E3) [NB300-140] - Section of rat facial nucleus 7 days following axotomy. These neurons are capable of regenerating their axons and also, concomitant with regeneration, strongly upregulate alpha-Internexin in their perikarya. Other central neurons which are not able to regenerate their axons do not upregulate this protein after axotomy and untreated facial neurons normally show only very low levels of alpha-Internexin. Both findings suggest that alpha-Internexin has a role in axonal regeneration.
Immunocytochemistry/Immunofluorescence: alpha-Internexin Antibody (2E3) [NB300-140] - Hippocampal neurons in tissue culture with neurofilament alpha internexin (red), using NB300-140 and GFAP (green), using NB300-141.
(33 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Tau [p Thr181]
Antibody
NB100-82245
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Western blot analysis of extract from mouse brain tissue using Tau (Ab-181) antibody ( Lane 1 and 2) and Tau (phospho-Thr181) antibody ( Lane 3 and 4).
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - Analysis of extracts from mouse brain tissue using Tau(Phospho-Thr181) Antibody and the same antibody preincubated with blocking peptide.
Western Blot: Tau [p Thr181] Antibody [NB100-82245] - PPP2R2C level regulates Tau phosphatase levels. Representative image of immunoblots of indicated antibodies are shown in SHSY5Y cell lines after knockdown and overexpression PPP2R2C. Image collected and cropped by CiteAb from the following publication (www.aging-us.com/lookup/doi/10.18632/aging.103048) licensed under a CC-BY licence.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
MAP2 Antibody
NB300-213
Western Blot: MAP2 Antibody [NB300-213] - Western blot analysis of whole brain tissue lysates using chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:50,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain, [4] adult mouse brain. Strong band observed at ~280 kDa mark corresponds to two major isoforms of MAP2 protein referred to as MAP2A and MAP2B. Smaller fragments of these isoforms are also detected if the antibody is used at higher concentrations.
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Human DA neurons 28 DIV stained with MAP2 antibody (blue). ICC/IF image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Immunofluorescent analysis of cortical neuron-glial cell culture from E20 rat stained with chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:10,000 in red, and mouse mAb to MAP-tau, NPB2-25162, dilution 1:2,000, in green. The blue is DAPI staining of nuclear DNA. NB300-213 antibody stains dendrites and perikarya of neurons, while NBP2-25162 antibody labels neuronal perikarya, dendrites and also axonal process. As a result perikarya and dendrites appears orange-yellow, since they contain both MAP2 and tau, while axons are green.
(5 Reviews)
(78 Publications)
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
Peripherin Antibody
NB300-137
Immunocytochemistry/Immunofluorescence: Peripherin Antibody [NB300-137] - Mixed neuron/glia cultures from newborn rat brain stained with NB300-137 antibody to peripherin (green) and chicken polyclonal antibody to phosphorylated NF-H (red channel). A class of large neurons, like the one at the top right of this image, contain peripherin, while the majority of neurons and their processes contain NF-H and not peripherin. The blue channel reveals the localization of DNA.
Immunocytochemistry/Immunofluorescence: Peripherin Antibody [NB300-137] - Analysis of the widely used rat pheochromocytoma PC12 cell line stained with rabbit polyclonal Periphren antibody, dilution 1:2000 (Green). Hoechst staining of nuclear DNA (Blue). Peripherin, one of the Class III family of intermediate filament subunit proteins, is a major component of the PC12 cell forming a perinuclear cap, with some filaments visible in the cytoplasm.
Western Blot: Peripherin Antibody [NB300-137] - Analysis of tissue and cell lysates using Peripherin antibody, dilution 1:10000 in green: [1] protein standard, [2] rat spinal cord, [3] mouse spinal cord, [4] pig spinal cord, [5] cow spinal cord, [6] SH-SY5Y cells and [7] PC12 cells. The major band at ~57kDa corresponds to the major peripherin protein isoform, while other bands presumably represent protein products of alternate transcripts of the peripherin gene.
(1 Review)
(7 Publications)
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Cdk5 Antibody
NBP2-15843
Western Blot: Cdk5 Antibody [NBP2-15843] - Wild-type (WT) and CDK5 knockout (KO) 293T cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with CDK5 antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody
Immunohistochemistry-Paraffin: Cdk5 Antibody [NBP2-15843] - ES2 xenograft, using CDK5 antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Immunocytochemistry/Immunofluorescence: Cdk5 Antibody [NBP2-15843] - Analysis of paraformaldehyde-fixed A549, using antibody at 1:200 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Nestin Antibody
(196908)
MAB1259
Nestin was detected in immersion fixed human fetal neural progenitor cells using 10 µg/mL Human Nestin Monoclonal Antibody (Catalog # MAB1259) for 3 hours at room temperature. Cells were stained (green) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
A172 cells were stained with Mouse Anti-Human Nestin Monoclonal Antibody (Catalog # MAB1259, filled histogram) or isotype control antibody (Catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). To facilitate intracellular staining, cells were fixed and permeabilized with FlowX FoxP3 Fixation & Permeabilization Buffer Kit (Catalog # FC012). View our protocol for Staining Intracellular Molecules.
(3 Reviews)
(97 Publications)
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
Desmin Antibody
AF3844
Desmin was detected in immersion fixed frozen sections of mouse skeletal muscle using Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to z-lines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Desmin was detected in immersion fixed paraffin-embedded sections of human heart using 15 µg/mL Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the sarcoplasm of cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(16 Publications)
Species: Hu, Mu
Applications: IHC
Enolase
2/Neuron-specific Eno ...
NB110-58870
Immunocytochemistry/Immunofluorescence: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Analysis of mixed cortical neuron-glial cell culture from E20 rat stained with rabbit pAb to neuron specific enolase (NSE), NB110-58870, dilution 1:500 in red, and costained with chicken pAb to GFAP, dilution 1:5,000 in green. The blue is Hoechst staining of nuclear DNA. the NSE antibody labels protein expressed in neuronal cells, while the GFAP antibody stains intermediate filaments in astrocytic and certain other glial cells.
Western Blot: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Analysis of different tissue and cell lysates using rabbit pAb to neuron specific enolase (NSE), NB110-58870, dilution 1:5,000 in green: [1] protein standard (red), [2] rat brain, [3] rat spinal cord, [4] mouse brain, [5] mouse spinal cord, [6] NIH-3T3, [7] HEK293, [8] HeLa, [9] SH-SY5Y, and [10] C6 cells. A single band at about 47kDa corresponds to the NSE protein, seen only in extracts containing neurons ro neuronal lineage cells.
Simple Western: Enolase 2/Neuron-specific Enolase Antibody [NB110-58870] - Simple Western lane view shows a specific band for Enolase 2/ Neuron specific enolase in 0.05 mg/ml of Human Brain lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(2 Reviews)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KD, Simple Western, WB
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Bovine ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunohistochemistry-Paraffin: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Analysis of Superoxide Dismutase 1 in FFPE human liver tissue using an isotype control (top) and NBP2-24915 (bottom) at 5 ug/ml.
(3 Reviews)
(13 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Methionine
Aminopeptidase 2/META ...
NBP3-05513
Immunocytochemistry/Immunofluorescence: Methionine Aminopeptidase 2/METAP2 Antibody [NBP3-05513] - Staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: Methionine Aminopeptidase 2/METAP2 Antibody [NBP3-05513] - Staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Western Blot: Methionine Aminopeptidase 2/METAP2 Antibody [NBP3-05513] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-METAP2 antibody. Remaining relative intensity is presented.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
(OTI6E5)
NBP1-47842
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Endometrium tissue within the normal limits using antiMAPK1mouse monoclonal antibody. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 100C for 10min,Dilution 1:50)
Immunoprecipitation: ERK2 Antibody (6E5) [NBP1-47842] - TrueMab monoclonal anti-ERK2 antibody (Negative control: IP without adding anti-ERK2 antibody). For each experiment, 500ul of DDK tagged ERK2 overexpression lysates (at 1:5 dilution with HEK293T lysate), 2ug of antibody.
Immunohistochemistry-Paraffin: ERK2 Antibody (6E5) [NBP1-47842] - Staining of paraffin-embedded Adenocarcinoma of colon tissue using anti-ERK2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NF-M Antibody
(CL2688)
NBP2-46618
NF-M Antibody (CL2688)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NF-M Antibody (NBP2-46618)(1)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for NF-M Antibody (NBP2-46618) (0)

There are no reviews for NF-M Antibody (NBP2-46618). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NF-M Antibody (NBP2-46618) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NF-M Products

Bioinformatics Tool for NF-M Antibody (NBP2-46618)

Discover related pathways, diseases and genes to NF-M Antibody (NBP2-46618). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NF-M Antibody (NBP2-46618)

Discover more about diseases related to NF-M Antibody (NBP2-46618).
 

Pathways for NF-M Antibody (NBP2-46618)

View related products by pathway.

PTMs for NF-M Antibody (NBP2-46618)

Learn more about PTMs related to NF-M Antibody (NBP2-46618).
 

Research Areas for NF-M Antibody (NBP2-46618)

Find related products by research area.

Blogs on NF-M

There are no specific blogs for NF-M, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NF-M Antibody (CL2688) and receive a gift card or discount.


Bioinformatics

Gene Symbol NEFM
Entrez
Uniprot