Neurofascin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Neurofascin Antibody [NBP1-81886] - Staining in human cerebral cortex and pancreas tissues using anti-NFASC antibody. Corresponding NFASC RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Neurofascin Antibody [NBP1-81886] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Neurofascin Antibody [NBP1-81886] - Staining of human cerebral cortex shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Neurofascin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFE
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFASC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
Neurofascin Protein (NBP1-81886PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neurofascin Antibody

  • DKFZp686P2250
  • KIAA0756FLJ46866
  • neurofascin homolog (chicken)
  • neurofascin homolog
  • Neurofascin
  • NF
  • NFASC
  • NRCAML

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-91499
Species: Bv, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-225
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-P, In vitro, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NBP2-67710
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89544
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-131
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NB300-135
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, WB
NB300-222
Species: Bv, Ch, Dr, Eq, Hu, Mu, Po, Rt
Applications: IB, ICC/IF, IHC-FrFl, IHC, KD, WB
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Neurofascin Antibody (NBP1-81886) (0)

There are no publications for Neurofascin Antibody (NBP1-81886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurofascin Antibody (NBP1-81886) (0)

There are no reviews for Neurofascin Antibody (NBP1-81886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neurofascin Antibody (NBP1-81886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Neurofascin Products

Bioinformatics Tool for Neurofascin Antibody (NBP1-81886)

Discover related pathways, diseases and genes to Neurofascin Antibody (NBP1-81886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurofascin Antibody (NBP1-81886)

Discover more about diseases related to Neurofascin Antibody (NBP1-81886).
 

Pathways for Neurofascin Antibody (NBP1-81886)

View related products by pathway.

PTMs for Neurofascin Antibody (NBP1-81886)

Learn more about PTMs related to Neurofascin Antibody (NBP1-81886).

Blogs on Neurofascin

There are no specific blogs for Neurofascin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurofascin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NFASC