Neurofascin Antibody

Images

 
Immunohistochemistry: Neurofascin Antibody [NBP1-81886] - Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mouse, RatSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

Neurofascin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITDYVVQFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NFASC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
HIER pH6 retrieval is recommended.
Control Peptide
Neurofascin Protein (NBP1-81886PEP)

Alternate Names for Neurofascin Antibody

  • DKFZp686P2250
  • KIAA0756FLJ46866
  • neurofascin homolog (chicken)
  • neurofascin homolog
  • Neurofascin
  • NF
  • NFASC
  • NRCAML

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB8930
Species: Hu
Applications: WB, Simple Western, ICC
MAB72261
Species: Hu
Applications: WB, Simple Western, ICC
MAB4364
Species: Rt
Applications: WB, IHC, IP, ICC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt, Po, Av, Fe, Fi, Rb, Xp
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-75039
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB300-135
Species: Hu, Mu, Rt, Po, Bv, Fe
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-133
Species: Hu, Mu, Rt, Po, Av, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF632
Species: Hu
Applications: WB, AgAct

Publications for Neurofascin Antibody (NBP1-81886) (0)

There are no publications for Neurofascin Antibody (NBP1-81886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurofascin Antibody (NBP1-81886) (0)

There are no reviews for Neurofascin Antibody (NBP1-81886). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neurofascin Antibody (NBP1-81886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neurofascin Antibody Products

Related Products by Gene

Bioinformatics Tool for Neurofascin Antibody (NBP1-81886)

Discover related pathways, diseases and genes to Neurofascin Antibody (NBP1-81886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurofascin Antibody (NBP1-81886)

Discover more about diseases related to Neurofascin Antibody (NBP1-81886).
 

Pathways for Neurofascin Antibody (NBP1-81886)

View related products by pathway.

PTMs for Neurofascin Antibody (NBP1-81886)

Learn more about PTMs related to Neurofascin Antibody (NBP1-81886).

Blogs on Neurofascin

There are no specific blogs for Neurofascin, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol NFASC
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81886 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought