NeuroD1 Antibody (3D11)

Images

 
Western Blot: NeuroD1 Antibody (3D11) [H00004760-M02] - Analysis of NEUROD1 expression in transfected 293T cell line by NEUROD1 monoclonal antibody (M02), clone 3D11.Lane 1: NEUROD1 transfected lysate(39.9 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: NeuroD1 Antibody (3D11) [H00004760-M02] - Analysis of monoclonal antibody to NEUROD1 on formalin-fixed paraffin-embedded human pancreas. Antibody concentration 3 ug/ml.
Sandwich ELISA: NeuroD1 Antibody (3D11) [H00004760-M02] - Detection limit for recombinant GST tagged NEUROD1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NeuroD1 Antibody (3D11) Summary

Immunogen
NEUROD1 (AAH09046 201 a.a. - 300 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
Specificity
NEUROD1 - neurogenic differentiation 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NEUROD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NeuroD1 Antibody (3D11)

  • basic helix-loop-helix transcription factor
  • BETA2
  • BHF-1
  • BHLHA3
  • bHLHa3beta-cell E-box transactivator 2
  • Class A basic helix-loop-helix protein 3
  • MODY6
  • NeuroD
  • NeuroD1
  • neurogenic differentiation 1
  • neurogenic differentiation factor 1
  • neurogenic helix-loop-helix protein NEUROD
  • NIDDM

Background

This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
AF3444
Species: Hu
Applications: WB
AF2567
Species: Mu
Applications: WB, IHC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3314
Species: Hu, Rt
Applications: IHC
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF2775
Species: Hu, Mu
Applications: WB
NBP1-49672
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF2614
Species: Hu
Applications: WB, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
AF6014
Species: Hu, Mu, Rt
Applications: WB
AF6116
Species: Hu
Applications: WB, ICC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82554
Species: Hu
Applications: WB, IHC, IHC-P
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow

Publications for NeuroD1 Antibody (H00004760-M02) (0)

There are no publications for NeuroD1 Antibody (H00004760-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NeuroD1 Antibody (H00004760-M02) (0)

There are no reviews for NeuroD1 Antibody (H00004760-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NeuroD1 Antibody (H00004760-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NeuroD1 Products

Bioinformatics Tool for NeuroD1 Antibody (H00004760-M02)

Discover related pathways, diseases and genes to NeuroD1 Antibody (H00004760-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NeuroD1 Antibody (H00004760-M02)

Discover more about diseases related to NeuroD1 Antibody (H00004760-M02).
 

Pathways for NeuroD1 Antibody (H00004760-M02)

View related products by pathway.

PTMs for NeuroD1 Antibody (H00004760-M02)

Learn more about PTMs related to NeuroD1 Antibody (H00004760-M02).
 

Research Areas for NeuroD1 Antibody (H00004760-M02)

Find related products by research area.

Blogs on NeuroD1

There are no specific blogs for NeuroD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NeuroD1 Antibody (3D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEUROD1
Entrez
OMIM
Uniprot