Neuregulin-2 Antibody

Images

 
Western Blot: Neuregulin-2 Antibody [NBP1-87971] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Neuregulin-2 Antibody [NBP1-87971] - Staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related Neuregulin-2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-87971
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Neuregulin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neuregulin-2 Antibody

  • divergent of neuregulin-1
  • DON1
  • Don-1
  • HRG2
  • neuregulin 2
  • NTAKneural- and thymus-derived activator for ErbB kinases
  • pro-neuregulin-2, membrane-bound isoform
  • pro-NRG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB3481
Species: Hu
Applications: Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF753
Species: Mu
Applications: WB, IHC
AF1195
Species: Hu
Applications: WB, IHC, Neut
AF-261-NA
Species: Hu
Applications: WB, IHC, Neut
NBP1-81709
Species: Hu
Applications: IHC, IHC-P
259-HE
Species: Hu
NBP2-34987
Species: Hu
MAB3446
Species: Hu
Applications: WB
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87971
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Neuregulin-2 Antibody (NBP1-87971) (0)

There are no publications for Neuregulin-2 Antibody (NBP1-87971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neuregulin-2 Antibody (NBP1-87971) (0)

There are no reviews for Neuregulin-2 Antibody (NBP1-87971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neuregulin-2 Antibody (NBP1-87971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neuregulin-2 Products

Bioinformatics Tool for Neuregulin-2 Antibody (NBP1-87971)

Discover related pathways, diseases and genes to Neuregulin-2 Antibody (NBP1-87971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neuregulin-2 Antibody (NBP1-87971)

Discover more about diseases related to Neuregulin-2 Antibody (NBP1-87971).
 

Pathways for Neuregulin-2 Antibody (NBP1-87971)

View related products by pathway.

PTMs for Neuregulin-2 Antibody (NBP1-87971)

Learn more about PTMs related to Neuregulin-2 Antibody (NBP1-87971).
 

Research Areas for Neuregulin-2 Antibody (NBP1-87971)

Find related products by research area.

Blogs on Neuregulin-2

There are no specific blogs for Neuregulin-2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neuregulin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRG2