NEU3 Antibody

Images

 
Immunohistochemistry: NEU3 Antibody [NBP2-32644] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry: NEU3 Antibody [NBP2-32644] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEU3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PLEAACWSRPWILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGRNPSQFK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEU3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NEU3 Protein (NBP2-32644PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEU3 Antibody

  • EC 3.2.1.18
  • FLJ12388
  • Ganglioside sialidase
  • Membrane sialidase
  • N-acetyl-alpha-neuraminidase 3
  • neuraminidase 3
  • SIAL3
  • sialidase 3 (membrane sialidase)
  • sialidase-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6860
Species: Hu
Applications: WB, IP
AF3638
Species: Hu
Applications: WB
NBP2-30039
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-32682
Species: Hu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC

Publications for NEU3 Antibody (NBP2-32644) (0)

There are no publications for NEU3 Antibody (NBP2-32644).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEU3 Antibody (NBP2-32644) (0)

There are no reviews for NEU3 Antibody (NBP2-32644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NEU3 Antibody (NBP2-32644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEU3 Products

Bioinformatics Tool for NEU3 Antibody (NBP2-32644)

Discover related pathways, diseases and genes to NEU3 Antibody (NBP2-32644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEU3 Antibody (NBP2-32644)

Discover more about diseases related to NEU3 Antibody (NBP2-32644).
 

Pathways for NEU3 Antibody (NBP2-32644)

View related products by pathway.

PTMs for NEU3 Antibody (NBP2-32644)

Learn more about PTMs related to NEU3 Antibody (NBP2-32644).

Blogs on NEU3

There are no specific blogs for NEU3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEU3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEU3