Neprilysin/CD10 Antibody - BSA Free

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human prostate.

Immunohistochemistry: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human small intestine shows membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human cerebral cortex shows low expression as expected.

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining in human small intestine and cerebral cortex tissues using anti-MME antibody. Corresponding MME RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human cerebral cortex, kidney, prostate and small intestine using Anti-MME antibody NBP2-48701 (A) shows similar protein distribution across tissues to independent antibody NBP2-49050 (B).

Immunohistochemistry-Paraffin: Neprilysin/CD10 Antibody [NBP2-48701] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neprilysin/CD10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neprilysin/CD10 Antibody - BSA Free (NBP2-48701) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: STVNISITNEEDVVVYAPEYLTKLKPILTKYSARDLQNLMSWRFIMDLVSSLSRTYKESRN
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MME
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Neprilysin/CD10 Recombinant Protein Antigen (NBP2-48701PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Neprilysin/CD10 Antibody - BSA Free

• Atriopeptidase
• CALLA
• CALLAmembrane metallo-endopeptidase (neutral endopeptidase, enkephalinase)
• CD10 antigen
• CD10
• CD10)
• CD10membrane metallo-endopeptidase variant 1
• Common acute lymphocytic leukemia antigen
• DKFZp686O16152
• EC 3.4.24
• EC 3.4.24.11
• Enkephalinase
• EPN
• Leu-19
• membrane metallo-endopeptidase variant 2
• membrane metallo-endopeptidase
• MGC126681
• MGC126707
• MME
• NEPmembrane metallo-endopeptidase (neutral endopeptidase, enkephalinase, CALLA
• Neprilysin
• Neutral Endopeptidase 24.11
• Neutral endopeptidase
• NKH1
• SFE
• Skin fibroblast elastase

Background

CD10, also known as the Common Acute Lymphocytic Leukemia Antigen (CALLA), is a cell surface enzyme with neutral metalloendopeptidase activity which inactivates a variety of biologically active peptides. CD10 is expressed on the cells of lymphoblastic, Burkitt's, and follicular germinal center lymphomas, immature B cells with in adult bone marrow and on cells from patients with chronic myelocytic leukemia (CML). CD10 is also present on breast myoepithelial cells, bile canaliculi, fibroblasts, with especially high expression on the brush border of kidney and gut epithelial cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MME