Nephronectin Antibody

Images

 
Western Blot: Nephronectin Antibody [NBP1-70658] - Sample Tissue: Human HepG2 Antibody Dilution: 1.0 ug/ml
Western Blot: Nephronectin Antibody [NBP1-70658] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nephronectin Antibody Summary

Immunogen
Synthetic peptides corresponding to NPNT(nephronectin) The peptide sequence was selected from the middle region of NPNT. Peptide sequence TTGLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQPSNDLFEIFE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPNT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NPNT and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nephronectin Antibody

  • EGFL6L
  • Nctn
  • Nephronectin
  • NPNT
  • POEM

Background

NPNT is a functional ligand of integrin alpha-8/beta-1 in kidney development. It regulates with integrin alpha-8/beta-1 the expression of GDNF which is essential for kidney development. It may also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF3025
Species: Hu
Applications: WB, ICC
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-32491
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
4329-EG
Species: Mu
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
AF4076
Species: Mu, Rt
Applications: WB, Simple Western, Flow, CyTOF-ready, ICC
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-70658
Species: Hu
Applications: WB

Publications for Nephronectin Antibody (NBP1-70658) (0)

There are no publications for Nephronectin Antibody (NBP1-70658).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nephronectin Antibody (NBP1-70658) (0)

There are no reviews for Nephronectin Antibody (NBP1-70658). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nephronectin Antibody (NBP1-70658) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nephronectin Products

Bioinformatics Tool for Nephronectin Antibody (NBP1-70658)

Discover related pathways, diseases and genes to Nephronectin Antibody (NBP1-70658). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nephronectin Antibody (NBP1-70658)

Discover more about diseases related to Nephronectin Antibody (NBP1-70658).
 

Pathways for Nephronectin Antibody (NBP1-70658)

View related products by pathway.

Blogs on Nephronectin

There are no specific blogs for Nephronectin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nephronectin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPNT
Entrez