Nephrin Antibody (3H6)

Western Blot: Nephrin Antibody (3H6) [H00004868-M02] - Detection against Immunogen (35.64 KDa) .

Product Discontinued

Nephrin Antibody (3H6) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: NPHS1 (NP_004637.1, 33 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NPHS1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nephrin Antibody (3H6)

• CNF
• Nephrin
• nephrosis 1, congenital, Finnish type (nephrin)
• NPHNCNF
• NPHS1
• Renal glomerulus-specific cell adhesion receptor

Background

The Nephrin gene encodes a member of the immunoglobulin family of cell adhesion molecules that functions in the glomerular filtration barrier in the kidney. The gene is primarily expressed in renal tissues, and the protein is a type-1 transmembrane protein found

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPHS1
• Uniprot:
  • NP_004637(Human)