Nephrin Antibody (3H6)

Images

 
There are currently no images for Nephrin Antibody (H00004868-M02).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nephrin Antibody (3H6) Summary

Immunogen
NPHS1 (NP_004637.1, 33 a.a. - 122 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NPHS1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nephrin Antibody (3H6)

  • CNF
  • Nephrin
  • nephrosis 1, congenital, Finnish type (nephrin)
  • NPHNCNF
  • NPHS1
  • Renal glomerulus-specific cell adhesion receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89818
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-39100
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-00142
Species: Hu, Mu
Applications: WB, IP, PEP-ELISA
H00004868-M02
Species: Hu
Applications: WB, ELISA

Publications for Nephrin Antibody (H00004868-M02) (0)

There are no publications for Nephrin Antibody (H00004868-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nephrin Antibody (H00004868-M02) (0)

There are no reviews for Nephrin Antibody (H00004868-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nephrin Antibody (H00004868-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nephrin Products

Bioinformatics Tool for Nephrin Antibody (H00004868-M02)

Discover related pathways, diseases and genes to Nephrin Antibody (H00004868-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nephrin Antibody (H00004868-M02)

Discover more about diseases related to Nephrin Antibody (H00004868-M02).
 

Pathways for Nephrin Antibody (H00004868-M02)

View related products by pathway.

PTMs for Nephrin Antibody (H00004868-M02)

Learn more about PTMs related to Nephrin Antibody (H00004868-M02).

Blogs on Nephrin

There are no specific blogs for Nephrin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nephrin Antibody (3H6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NPHS1
Entrez
Uniprot