Nephrin Antibody (3D2)

ELISA: Nephrin Antibody (3D2) [H00004868-M14] - Detection limit for recombinant GST tagged NPHS1 is 0.1 ng/ml as a capture antibody.

Product Discontinued

Nephrin Antibody (3D2) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: NPHS1 (NP_004637.1, 33 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPEL
• Specificity: This product is specific for Human NPHS1 monoclonal antibody (M14), clone 3D2 [Gene ID: 4868].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NPHS1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:100-1:2000

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nephrin Antibody (3D2)

• CNF
• Nephrin
• nephrosis 1, congenital, Finnish type (nephrin)
• NPHNCNF
• NPHS1
• Renal glomerulus-specific cell adhesion receptor

Background

The Nephrin gene encodes a member of the immunoglobulin family of cell adhesion molecules that functions in the glomerular filtration barrier in the kidney. The gene is primarily expressed in renal tissues, and the protein is a type-1 transmembrane protein found

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Nephrin Antibody (H00004868-M14). (Showing 1 - 1 of 1 FAQ).

1. I have a question regarding the Nephrin Ab with cat number H00004868-M14. Can we also purchase this antibody biotinylated?
   • Yes you could order this antibody (H00004868-M14, Nephrin Antibody/3D2) supplied in the biotinylated form.

Bioinformatics

• Gene Symbol: NPHS1
• Uniprot:
  • NP_004637.1(Human)