Neogenin Antibody

Images

 
Immunohistochemistry: Neogenin Antibody [NBP1-89653] - Staining of human duodenum shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neogenin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Neogenin Protein (NBP1-89653PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neogenin Antibody

  • HsT17534
  • IGDCC2DKFZp547B146
  • Immunoglobulin superfamily DCC subclass member 2
  • NEO
  • NEO1
  • neogenin (chicken) homolog 1
  • neogenin 1
  • neogenin homolog 1
  • Neogenin
  • NGN
  • NGNDKFZp547A066

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF844
Species: Mu
Applications: WB, Block
AF2458
Species: Mu
Applications: WB, IHC
AF3720
Species: Hu, Mu
Applications: WB, ICC
NBP1-47871
Species: Hu, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB3314
Species: Hu, Rt
Applications: IHC
AF1006
Species: Rt
Applications: WB, IHC
AF1005
Species: Hu
Applications: WB, IHC
AF3444
Species: Hu
Applications: WB
AF2429
Species: Mu
Applications: WB, IHC
AF1166
Species: Mu
Applications: WB
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1405
Species: Rt
Applications: WB, Block, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Neogenin Antibody (NBP1-89653) (0)

There are no publications for Neogenin Antibody (NBP1-89653).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neogenin Antibody (NBP1-89653) (0)

There are no reviews for Neogenin Antibody (NBP1-89653). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Neogenin Antibody (NBP1-89653) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neogenin Products

Bioinformatics Tool for Neogenin Antibody (NBP1-89653)

Discover related pathways, diseases and genes to Neogenin Antibody (NBP1-89653). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neogenin Antibody (NBP1-89653)

Discover more about diseases related to Neogenin Antibody (NBP1-89653).
 

Pathways for Neogenin Antibody (NBP1-89653)

View related products by pathway.

PTMs for Neogenin Antibody (NBP1-89653)

Learn more about PTMs related to Neogenin Antibody (NBP1-89653).

Blogs on Neogenin

There are no specific blogs for Neogenin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neogenin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEO1
Entrez