NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody

Images

 
Western Blot: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Western Blot: NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody [NBP1-92162] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDE
Specificity
Specificity of human, mouse, rat NEDD8 Activating Enzyme (APPBP1/UBA3) antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin: HIER pH6 retrieval method is recommended.
Theoretical MW
60 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
NEDD8 Activating Enzyme (APPBP1/UBA3) Protein (NBP1-92162PEP)
Publications
Read Publication using
NBP1-92162 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody

  • A-116A10.1
  • amyloid beta precursor protein binding protein 1
  • amyloid beta precursor protein binding protein 1, 59kDa
  • Amyloid beta precursor protein-binding protein 1, 59 kDa
  • amyloid beta precursor protein-binding protein 1, 59kD
  • Amyloid protein-binding protein 1
  • APPBP1APP-BP1
  • NEDD8 Activating Enzyme (APPBP1/UBA3)
  • NEDD8 activating enzyme E1 subunit 1
  • NEDD8-activating enzyme E1 regulatory subunit
  • NEDD8-activating enzyme E1 subunit
  • protooncogene protein 1
  • Proto-oncogene protein 1
  • ula-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01863
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-49443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-55035
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3765
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-91774
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF

Publications for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162) (0)

There are no reviews for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162)

Discover related pathways, diseases and genes to NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162)

Discover more about diseases related to NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162).
 

Pathways for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162)

View related products by pathway.

Research Areas for NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody (NBP1-92162)

Find related products by research area.

Blogs on NEDD8 Activating Enzyme (APPBP1/UBA3)

There are no specific blogs for NEDD8 Activating Enzyme (APPBP1/UBA3), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDD8 Activating Enzyme (APPBP1/UBA3) Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAE1
Entrez
Uniprot