Troponin T type 1 (slow skeletal) Antibody

Images

 
Western Blot: Troponin T type 1 (slow skeletal) Antibody [H00007138-B01P] - Human skeletal muscle lysate. Image from verified customer review.
Western Blot: Troponin T type 1 (slow skeletal) Antibody [H00007138-B01P] - Analysis of TNNT1 expression in transfected 293T cell line by TNNT1 polyclonal antibody. Lane 1: TNNT1 transfected lysate(27.61 KDa). Lane 2: ...read more
Western Blot: Troponin T type 1 (slow skeletal) Antibody [H00007138-B01P] - Analysis of TNNT1 expression in SJCRH30.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Troponin T type 1 (slow skeletal) Antibody Summary

Immunogen
TNNT1 (NP_003274, 1 a.a. - 251 a.a.) full-length human protein. MSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
Specificity
TNNT1 - troponin T type 1 (skeletal, slow),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TNNT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 4
using
H00007138-B01P in the following application:

Publications
Read Publications using
H00007138-B01P in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Troponin T type 1 (slow skeletal) Antibody

  • ANMtroponin T, slow skeletal muscle
  • FLJ98147
  • MGC104241
  • Slow skeletal muscle troponin T
  • STNT
  • TnTs
  • TNTtroponin T1, skeletal, slow
  • troponin T type 1 (skeletal, slow)
  • troponin-T1, skeletal, slow

Background

This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55151
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-67584
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92534
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56146
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF3894
Species: Mu
Applications: WB, Flow, IP, CyTOF-ready, ICC
AF5739
Species: Hu, Mu, Rt
Applications: WB
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-92088
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46201
Species: Hu
Applications: WB, IHC
NBP1-90260
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-90276
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007138-B01P
Species: Hu
Applications: WB

Publications for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P)(2)

We have publications tested in 1 confirmed species: Mollusca.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mollusca
(1)
All Species

Review for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using H00007138-B01P:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Troponin T type 1 (slow skeletal) H00007138-B01P
Enlarge
reviewed by:
Margherita verardo
WB Human 06/14/2018
View

Summary

ApplicationWestern Blot
Sample TestedHuman Skeletal Muscle Lysate
SpeciesHuman
Lot08255 WULz

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P)

Discover related pathways, diseases and genes to Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P)

Discover more about diseases related to Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P).
 

Pathways for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P)

View related products by pathway.

PTMs for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P)

Learn more about PTMs related to Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P).
 

Research Areas for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P)

Find related products by research area.

Blogs on Troponin T type 1 (slow skeletal)

There are no specific blogs for Troponin T type 1 (slow skeletal), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Margherita verardo
06/14/2018
Application: WB
Species: Human

Bioinformatics

Gene Symbol TNNT1
Entrez
Uniprot