Troponin T type 1 (slow skeletal) Antibody

Western Blot: Troponin T type 1 (slow skeletal) Antibody [H00007138-B01P] - Human skeletal muscle lysate. Image from verified customer review.

Western Blot: Troponin T type 1 (slow skeletal) Antibody [H00007138-B01P] - Analysis of TNNT1 expression in transfected 293T cell line by TNNT1 polyclonal antibody. Lane 1: TNNT1 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.

Western Blot: Troponin T type 1 (slow skeletal) Antibody [H00007138-B01P] - Analysis of TNNT1 expression in SJCRH30.

• Reactivity: Hu, In
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated

Troponin T type 1 (slow skeletal) Antibody Summary

• Immunogen: TNNT1 (NP_003274, 1 a.a. - 251 a.a.) full-length human protein. MSDTEEQEYEEEQPEEEAAEEEEEEEERPKPSRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQTLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEEAKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMGEEQLREKAQELSDWIHQLESEKFDLMAKLKQQKYEINVLYNRISHAQKFRKGAGKGRVGGRWK
• Specificity: TNNT1 - troponin T type 1 (skeletal, slow),
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TNNT1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Reactivity Notes

invertebrate reactivity reported in scientific literature (PMID: 26213227).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Troponin T type 1 (slow skeletal) Antibody

• ANMtroponin T, slow skeletal muscle
• FLJ98147
• MGC104241
• Slow skeletal muscle troponin T
• STNT
• TnTs
• TNTtroponin T1, skeletal, slow
• troponin T type 1 (skeletal, slow)
• troponin-T1, skeletal, slow

Background

This gene encodes a protein that is a subunit of troponin, which is a regulatory complex located on the thin filament of the sarcomere. This complex regulates striated muscle contraction in response to fluctuations in intracellular calcium concentration. This complex is composed of three subunits: troponin C, which binds calcium, troponin T, which binds tropomyosin, and troponin I, which is an inhibitory subunit. This protein is the slow skeletal troponin T subunit. Mutations in this gene cause nemaline myopathy type 5, also known as Amish nemaline myopathy, a neuromuscular disorder characterized by muscle weakness and rod-shaped, or nemaline, inclusions in skeletal muscle fibers which affects infants, resulting in death due to respiratory insufficiency, usually in the second year. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P)(2)

Publications using H00007138-B01P

• Vyatchin IG, Shevchenko UV, Lazarev SS et al. Troponin-like regulation in muscle thin filaments of the mussel Crenomytilus grayanus (Bivalvia: Mytiloida) Biochim. Biophys. Acta. 2015-07-26 [PMID: 26213227] (WB, Mollusca)
• Li H, Takai N, Yuge A et al. Novel target genes responsive to the anti-growth activity of triptolide in endometrial and ovarian cancer cells. Cancer Lett 2010-06-12 [PMID: 20547442]

Review for Troponin T type 1 (slow skeletal) Antibody (H00007138-B01P) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human.

reviewed by: Verified Customer WB Human 06/14/2018

Summary

• Application: Western Blot
• Sample Tested: Human Skeletal Muscle Lysate
• Species: Human
• Lot: 08255 WULz

Bioinformatics

• Gene Symbol: TNNT1
• Entrez:
  • 7138(Human)
• Uniprot:
  • NP_003274(Human)