NEBL Antibody

Images

 
Immunohistochemistry: NEBL Antibody [NBP1-86462] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEBL Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQGIMNKEPAVIGRPDFEHAVEASKLSSQIKYKEKFDNEMKDKKHHYNPLESASFRQNQLAATLASNVKYKKDIQNMHDPVSDLPNLLFLDHVLKASKMLSGREYKKLFEENKGMYHFDADAVEHLHHKGNAVLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEBL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NEBL Protein (NBP1-86462PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NEBL Antibody

  • Actin-binding Z-disk protein
  • FLJ53769
  • LASP2
  • LIM-nebulette
  • LNEBL
  • MGC119746
  • MGC119747
  • nebulette

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-11099
Species: Hu, Mu, Rt, Po, Al, Am, Av, Bv, Ch, Fi, Rb
Applications: WB, ICC/IF
NBP1-82844
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20861
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86267
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP2-02609
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90222
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
AF3876
Species: Hu, Mu
Applications: WB, IHC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NB600-507
Species: Hu, Mu
Applications: WB, PEP-ELISA
NBP1-86462
Species: Hu
Applications: IHC, IHC-P

Publications for NEBL Antibody (NBP1-86462) (0)

There are no publications for NEBL Antibody (NBP1-86462).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEBL Antibody (NBP1-86462) (0)

There are no reviews for NEBL Antibody (NBP1-86462). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NEBL Antibody (NBP1-86462) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEBL Products

Bioinformatics Tool for NEBL Antibody (NBP1-86462)

Discover related pathways, diseases and genes to NEBL Antibody (NBP1-86462). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEBL Antibody (NBP1-86462)

Discover more about diseases related to NEBL Antibody (NBP1-86462).
 

Pathways for NEBL Antibody (NBP1-86462)

View related products by pathway.

PTMs for NEBL Antibody (NBP1-86462)

Learn more about PTMs related to NEBL Antibody (NBP1-86462).

Blogs on NEBL

There are no specific blogs for NEBL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEBL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEBL