Home » NDUFS2 » NDUFS2 Antibodies » NDUFS2 Antibody

NDUFS2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NDUFS2 Antibody [NBP2-49351] - Analysis using Anti-NDUFS2 antibody NBP2-49351 (A) shows similar pattern to independent antibody NBP2-30413 (B).
Independent Antibodies: Western Blot: NDUFS2 Antibody [NBP2-49351] - Analysis using Anti-NDUFS2 antibody NBP2-49351 (A) shows similar pattern to independent antibody NBP2-30413 (B).
Immunohistochemistry: NDUFS2 Antibody [NBP2-49351] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

        

Order Details

100% Guarantee on every product

NDUFS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFS2 Recombinant Protein Antigen (NBP2-49351PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFS2 Antibody

  • CI-49
  • CI-49kD
  • complex 1, mitochondrial respiratory chain, 49-KD subunit
  • complex I 49kDa subunit
  • Complex I-49kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2 (49kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
  • NADH-ubiquinone oxidoreductase 49 kDa subunit
  • NADH-ubiquinone oxidoreductase NDUFS2 subunit

Background

Mitochondrial complex I (NADH-ubiquinone reductase; EC 1.6.5.3) is the first multimeric complex of the respiratory chain that catalyzes the NADH oxidation with concomitant ubiquinone reduction and proton ejection out of the mitochondria. Mammalian mitochondrial complex I is an assembly of at least 43 different subunits. Seven of the subunits are encoded by the mitochondrial genome; the remainder are the products of nuclear genes. The iron-sulfur protein (IP) fraction of complex I is made up of 7 subunits, including NDUFS2. See NDUFS1 (MIM 157655).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Ndufs1 Antibody
NBP1-31142
Western Blot: Ndufs1 Antibody [NBP1-31142] - 50 ug mouse brain lysate/extract 7. 5 % SDS-PAGE gel, antibody dilution 1:500.
Western Blot: Ndufs1 Antibody [NBP1-31142] - Hep G2 7.5% SDS PAGE diluted at 1:1500
Western Blot: Ndufs1 Antibody [NBP1-31142] - Sample (50 ug of whole cell lysate) A: Mouse brain 7. 5% SDS PAGE; antibody diluted at 1:10000.
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NDUFV1 Antibody
NBP1-33074
Knockout Validated: NDUFV1 Antibody [NBP1-33074] - Wild-type (WT) and NDUFV1 knockout (KO) 293T cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with NDUFV1 antibody [N3C3] diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Immunohistochemistry-Paraffin: NDUFV1 Antibody [NBP1-33074] - Paraffin-embedded mouse kidney. NDUFV1 antibody [N3C3] diluted at 1:500.
Immunohistochemistry-Paraffin: NDUFV1 Antibody [NBP1-33074] - Paraffin-embedded mouse stomach. NDUFV1 antibody [N3C3] diluted at 1:500.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, KO, WB
NDUFS7 Antibody
NBP1-49846
Immunohistochemistry-Paraffin: NDUFS7 Antibody [NBP1-49846] - Staining of paraffin embedded Human Cortex at dilution of 5ug/ml. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: NDUFS7 Antibody [NBP1-49846] - Staining of paraffin embedded Human Liver at dilution of 5ug/ml. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: NDUFS7 Antibody [NBP1-49846] - (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NDUFS8 Antibody
NBP1-85620
Immunohistochemistry-Paraffin: NDUFS8 Antibody [NBP1-85620] - Staining of human stomach shows strong cytoplasmic positivity in parietal cells.
Immunocytochemistry/Immunofluorescence: NDUFS8 Antibody [NBP1-85620] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Ndufs4 Antibody
NBP1-31465
Immunocytochemistry/Immunofluorescence: Ndufs4 Antibody [NBP1-31465] - Analysis of methanol-fixed HeLa, using antibody at 1:100 dilution.
Immunohistochemistry-Paraffin: Ndufs4 Antibody [NBP1-31465] - Human ovarian cancer, using NDUFS4 antibody at 1:100 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
Western Blot: Ndufs4 Antibody [NBP1-31465] - Sample (50 ug of whole cell lysate) A: Mouse brain 12% SDS PAGE; antibody diluted at 1:1000.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NDUFS3 Antibody
(JU10-32)
NBP2-75587
Immunocytochemistry/Immunofluorescence: NDUFS3 Antibody (JU10-32) [NBP2-75587] - Staining NDUFS3 in PC-3M cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: NDUFS3 Antibody (JU10-32) [NBP2-75587] - Staining NDUFS3 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: NDUFS3 Antibody (JU10-32) [NBP2-75587] - Analysis of paraffin-embedded human colon cancer tissues using anti-NDUFS3 receptor 2 antibody. Counter stained with hematoxylin.
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
NDUFV2 Antibody
NBP1-84475
Immunohistochemistry-Paraffin: NDUFV2 Antibody [NBP1-84475] - Staining of human kidney shows strong positivity in mitochondria in cells in tubules.
Immunohistochemistry-Paraffin: NDUFV2 Antibody [NBP1-84475] - Staining of human testis shows weak to moderate positivity in mitochondria in Leydig cells.
Immunohistochemistry-Paraffin: NDUFV2 Antibody [NBP1-84475] - Staining of human soft tissues shows no positivity in fibroblasts.
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NDUFS6 Antibody
NBP1-49831
Western Blot: NDUFS6 Antibody [NBP1-49831] - (0.01ug/ml) staining of Human Heart lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: NDUFS6 Antibody [NBP1-49831] - 5ug/ml staining of paraffin embedded Human Kidney. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: NDUFS6 Antibody [NBP1-49831] - Analysis of Mouse (A) and Rat (B) Heart lysates (35 ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
HSP60 Antibody -
BSA Free
NBP1-77397
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody conjugated to Alexa Fluor 488 (NBP1-77397AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody - BSA Free [NBP1-77397] - Mouse MS1 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 2ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(4 Reviews)
(5 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Endothelin-1 [HRP]
QET00B
(40 Publications)
Species: Hu
Applications: ELISA
COX15 Antibody
NBP1-59560
Western Blot: COX15 Antibody [NBP1-59560] - Titration: 5.0ug/ml Positive Control: HepG2 cell lysate.
Immunohistochemistry-Paraffin: COX15 Antibody [NBP1-59560] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: COX15 Antibody [NBP1-59560] - Lanes: Lane1 : 20 ug human fibroblast mitochondria Primary, Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-Rabbit HRP Secondary, Antibody Dilution: 1 : 5000 Gene name: COX15.
Species: Hu
Applications: IHC, IHC-P, WB
UQCRC1 Antibody
(OTI1G6)
NBP2-03825
Flow Cytometry: UQCRC1 Antibody (OTI1G6) [NBP2-03825] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-UQCRC1 antibody, and then analyzed by flow cytometry.
Immunohistochemistry-Paraffin: UQCRC1 Antibody (OTI1G6) [NBP2-03825] - Staining of paraffin-embedded Carcinoma of Human liver tissue using anti-UQCRC1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: UQCRC1 Antibody (OTI1G6) [NBP2-03825] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-UQCRC1 mouse monoclonal antibody.
(2 Publications)
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Norrin/NDP Antibody
AF3014
Norrin/NDP Antibody
(4 Publications)
Species: Hu
Applications: Block, IHC, WB
NDUFA6 Antibody
NBP2-93398
Western Blot: NDUFA6 Antibody [NBP2-93398] - Analysis of extracts of various cell lines, using NDUFA6 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.
Species: Hu, Mu, Rt
Applications: WB
NDUFAB1 Antibody
NBP2-33710
Immunohistochemistry-Paraffin: NDUFAB1 Antibody [NBP2-33710] - Staining of human cerebellum shows strong nuclear and cytoplasmic positivity in Purkinje cells.
Immunocytochemistry/Immunofluorescence: NDUFAB1 Antibody [NBP2-33710] - Staining of human cell line U-2 OS shows localization to mitochondria.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NDUFA9 Antibody
(3D7)
H00004704-M01
Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7 Analysis of NDUFA9 expression in NIH/3T3.
Immunocytochemistry/Immunofluorescence: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on NIH/3T3 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 0.8 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NDUFB4 Antibody
NBP3-03538
Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of L929 cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: NDUFB4 Antibody [NBP3-03538] - Analysis of U-2 OS cells using NDUFB4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Knockout Validated: NDUFB4 Antibody [NBP3-03538] - Analysis of extracts from normal (control) and NDUFB4 knockout (KO) HeLa cells, using NDUFB4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin: NDUFB6 Antibody [NBP1-92172] - Staining of human prostate shows strong cytoplasmic positivity with granular pattern in glandular cells.
Western Blot: NDUFB6 Antibody [NBP1-92172] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: NDUFB6 Antibody [NBP1-92172] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NDUFAF4 Antibody
NBP2-93264
Immunocytochemistry/Immunofluorescence: NDUFAF4 Antibody [NBP2-93264] - Analysis of HeLa cells using NDUFAF4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: NDUFAF4 Antibody [NBP2-93264] - Analysis of extracts of various cell lines, using NDUFAF4 .Exposure time: 30s.
Immunocytochemistry/Immunofluorescence: NDUFAF4 Antibody [NBP2-93264] - Analysis of L929 cells using NDUFAF4 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NDUFS2 Antibody
NBP2-49351
NDUFS2 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NDUFS2 Antibody (NBP2-49351) (0)

There are no publications for NDUFS2 Antibody (NBP2-49351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS2 Antibody (NBP2-49351) (0)

There are no reviews for NDUFS2 Antibody (NBP2-49351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFS2 Antibody (NBP2-49351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFS2 Products

Bioinformatics Tool for NDUFS2 Antibody (NBP2-49351)

Discover related pathways, diseases and genes to NDUFS2 Antibody (NBP2-49351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS2 Antibody (NBP2-49351)

Discover more about diseases related to NDUFS2 Antibody (NBP2-49351).
 

Pathways for NDUFS2 Antibody (NBP2-49351)

View related products by pathway.

PTMs for NDUFS2 Antibody (NBP2-49351)

Learn more about PTMs related to NDUFS2 Antibody (NBP2-49351).
 

Research Areas for NDUFS2 Antibody (NBP2-49351)

Find related products by research area.

Blogs on NDUFS2

There are no specific blogs for NDUFS2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFS2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NDUFS2