NDUFS2 Antibody

Images

 
Independent Antibodies: Western Blot: NDUFS2 Antibody [NBP2-49351] - Analysis using Anti-NDUFS2 antibody NBP2-49351 (A) shows similar pattern to independent antibody NBP2-30413 (B).
Immunohistochemistry: NDUFS2 Antibody [NBP2-49351] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

NDUFS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPVGSRGDCYDRYLCRVEEMRQSLRIIAQCLNKMP
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFS2 Recombinant Protein Antigen (NBP2-49351PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFS2 Antibody

  • CI-49
  • CI-49kD
  • complex 1, mitochondrial respiratory chain, 49-KD subunit
  • complex I 49kDa subunit
  • Complex I-49kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2 (49kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
  • NADH-ubiquinone oxidoreductase 49 kDa subunit
  • NADH-ubiquinone oxidoreductase NDUFS2 subunit

Background

Mitochondrial complex I (NADH-ubiquinone reductase; EC 1.6.5.3) is the first multimeric complex of the respiratory chain that catalyzes the NADH oxidation with concomitant ubiquinone reduction and proton ejection out of the mitochondria. Mammalian mitochondrial complex I is an assembly of at least 43 different subunits. Seven of the subunits are encoded by the mitochondrial genome; the remainder are the products of nuclear genes. The iron-sulfur protein (IP) fraction of complex I is made up of 7 subunits, including NDUFS2. See NDUFS1 (MIM 157655).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31142
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-33074
Species: Hu, Mu
Applications: IHC, IHC-P, KO, WB
NBP1-49846
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-75587
Species: Hu
Applications: ICC/IF, IHC-P, IP, WB
NBP1-84475
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-49831
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
QET00B
Species: Hu
Applications: ELISA
NBP1-59560
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-03825
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
AF3014
Species: Hu
Applications: Block, IHC, WB
NBP2-93398
Species: Hu, Mu, Rt
Applications: WB
NBP2-33710
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00004704-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP3-03538
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-93264
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-49351
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NDUFS2 Antibody (NBP2-49351) (0)

There are no publications for NDUFS2 Antibody (NBP2-49351).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS2 Antibody (NBP2-49351) (0)

There are no reviews for NDUFS2 Antibody (NBP2-49351). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFS2 Antibody (NBP2-49351) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFS2 Products

Bioinformatics Tool for NDUFS2 Antibody (NBP2-49351)

Discover related pathways, diseases and genes to NDUFS2 Antibody (NBP2-49351). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS2 Antibody (NBP2-49351)

Discover more about diseases related to NDUFS2 Antibody (NBP2-49351).
 

Pathways for NDUFS2 Antibody (NBP2-49351)

View related products by pathway.

PTMs for NDUFS2 Antibody (NBP2-49351)

Learn more about PTMs related to NDUFS2 Antibody (NBP2-49351).
 

Research Areas for NDUFS2 Antibody (NBP2-49351)

Find related products by research area.

Blogs on NDUFS2

There are no specific blogs for NDUFS2, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS2