NDUFA9 Antibody (3D7)

Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7 Analysis of NDUFA9 expression in NIH/3T3.

Immunocytochemistry/Immunofluorescence: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on NIH/3T3 cell. Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 0.8 ug/ml.

Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7. Analysis of NDUFA9 expression in PC-12.

Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7. Analysis of NDUFA9 expression in Raw 264.7.

Sandwich ELISA: NDUFA9 Antibody (3D7) [H00004704-M01] - Detection limit for recombinant GST tagged NDUFA9 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
• Clone: 3D7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

NDUFA9 Antibody (3D7) Summary

• Immunogen: NDUFA9 (NP_004993, 303 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
• Specificity: NDUFA9 - NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NDUFA9
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA9 Antibody (3D7)

• CC6
• CI39k
• CI-39k
• CI-39kD
• complex I 39kDa subunit
• Complex I-39kD
• MGC111043
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
• NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase)
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
• NADH-ubiquinone oxidoreductase 39 kDa subunit
• NDUFS2L
• SDR22E1
• short chain dehydrogenase/reductase family 22E, member 1

Background

ATP is generated via oxidative phosphorylation (Oxphos) in the mitochondria of almost all cells. The protein components of Oxphos, 4 respiratory chain complexes (I-IV) and an ATP synthase, are encoded in both the mitochondrial and nuclear genomes. Of the 4 respiratory chain complexes, complex I is the largest at 900 kD and contains at least 41 polypeptide subunits, 7 of which are encoded in the mitochondria, the remaining subunits are encoded in the nucleus. The multisubunit NADH:ubiquinone oxidoreductase is the first enzyme complex. By use of chaotropic agents, complex I can be fragmented into 3 different fractions. The flavoprotein fraction contains the NDUFV1, NDUFV2, and NDUFV3 subunits. The iron-sulfur protein (IP) fraction contains at least 7 subunits, NDUFS1-NDUFS6 and NDUFA5. The remaining subunits are part of the hydrophobic protein (HP) fraction. NDUFA9 is part of the hydrophobic protein fraction of the enzyme complex. However, it is predominantly hydrophilic, and appears to lie mostly outside the lipid bilayer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA9
• Entrez:
  • 4704(Human)
• OMIM:
  • 603834(Human)
• Uniprot:
  • NP_004993(Human)