NDUFA9 Antibody (3D7)


Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7 Analysis of NDUFA9 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on NIH/3T3 cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: NDUFA9 Antibody (3D7) [H00004704-M01] - Analysis of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 0.8 ug/ml.
Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7. Analysis of NDUFA9 expression in PC-12.
Western Blot: NDUFA9 Antibody (3D7) [H00004704-M01] - NDUFA9 monoclonal antibody (M01), clone 3D7. Analysis of NDUFA9 expression in Raw 264.7.
Sandwich ELISA: NDUFA9 Antibody (3D7) [H00004704-M01] - Detection limit for recombinant GST tagged NDUFA9 is approximately 0.1ng/ml as a capture antibody.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC

Order Details

NDUFA9 Antibody (3D7) Summary

Quality control test: Antibody Reactive Against Recombinant Protein.
NDUFA9 (NP_004993, 303 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI
NDUFA9 - NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
In 1x PBS, pH 7.4
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NDUFA9 Antibody (3D7)

  • CC6
  • CI39k
  • CI-39k
  • CI-39kD
  • complex I 39kDa subunit
  • Complex I-39kD
  • MGC111043
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase)
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
  • NADH-ubiquinone oxidoreductase 39 kDa subunit
  • SDR22E1
  • short chain dehydrogenase/reductase family 22E, member 1


ATP is generated via oxidative phosphorylation (Oxphos) in the mitochondria of almost all cells. The protein components of Oxphos, 4 respiratory chain complexes (I-IV) and an ATP synthase, are encoded in both the mitochondrial and nuclear genomes. Of the 4 respiratory chain complexes, complex I is the largest at 900 kD and contains at least 41 polypeptide subunits, 7 of which are encoded in the mitochondria, the remaining subunits are encoded in the nucleus. The multisubunit NADH:ubiquinone oxidoreductase is the first enzyme complex. By use of chaotropic agents, complex I can be fragmented into 3 different fractions. The flavoprotein fraction contains the NDUFV1, NDUFV2, and NDUFV3 subunits. The iron-sulfur protein (IP) fraction contains at least 7 subunits, NDUFS1-NDUFS6 and NDUFA5. The remaining subunits are part of the hydrophobic protein (HP) fraction. NDUFA9 is part of the hydrophobic protein fraction of the enzyme complex. However, it is predominantly hydrophilic, and appears to lie mostly outside the lipid bilayer.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDUFA9 Antibody (H00004704-M01) (0)

There are no publications for NDUFA9 Antibody (H00004704-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA9 Antibody (H00004704-M01) (0)

There are no reviews for NDUFA9 Antibody (H00004704-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFA9 Antibody (H00004704-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NDUFA9 Products

Research Areas for NDUFA9 Antibody (H00004704-M01)

Find related products by research area.

Blogs on NDUFA9

There are no specific blogs for NDUFA9, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFA9 Antibody (3D7) and receive a gift card or discount.


Gene Symbol NDUFA9