NDUFV2 Antibody

Images

 
Immunohistochemistry-Paraffin: NDUFV2 Antibody [NBP1-84475] - Staining of human heart muscle shows strong positivity in mitochondria in cardiomyocytes.
Immunohistochemistry-Paraffin: NDUFV2 Antibody [NBP1-84475] - Staining of human kidney shows strong positivity in mitochondria in cells in tubules.
Immunohistochemistry-Paraffin: NDUFV2 Antibody [NBP1-84475] - Staining of human testis shows weak to moderate positivity in mitochondria in Leydig cells.
Immunohistochemistry-Paraffin: NDUFV2 Antibody [NBP1-84475] - Staining of human soft tissues shows no positivity in fibroblasts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFV2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEE
Specificity
Specificity of human, mouse NDUFV2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFV2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFV2 Protein (NBP1-84475PEP)
Publications
Read Publications using
NBP1-84475 in the following applications:

  • WB
    2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23688429).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFV2 Antibody

  • CI-24k
  • mitochondrial respitory chain, 24 kD subunit
  • NADH dehydrogenase (ubiquinone) flavoprotein 2 (24kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
  • NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
  • NADH dehydrogenase ubiquinone flavoprotein 2, mitochondrial
  • NADH-ubiquinone oxidoreductase 24 kDa subunit
  • NADH-ubiquinone oxidoreductase flavoprotein 2
  • nuclear-encoded mitochondrial NADH-ubiquinone reductase 24Kd subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33074
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-75587
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE, Flow-CS
248-BD
Species: Hu, Mu, Rt, Ca, Eq
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP1-89026
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-49846
Species: Hu
Applications: WB, IP, PEP-ELISA
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50028
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83002
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-66200
Species: Hu
NBP1-85299
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for NDUFV2 Antibody (NBP1-84475)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(2)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for NDUFV2 Antibody (NBP1-84475) (0)

There are no reviews for NDUFV2 Antibody (NBP1-84475). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NDUFV2 Antibody (NBP1-84475) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NDUFV2 Antibody (NBP1-84475)

Discover related pathways, diseases and genes to NDUFV2 Antibody (NBP1-84475). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV2 Antibody (NBP1-84475)

Discover more about diseases related to NDUFV2 Antibody (NBP1-84475).
 

Pathways for NDUFV2 Antibody (NBP1-84475)

View related products by pathway.

PTMs for NDUFV2 Antibody (NBP1-84475)

Learn more about PTMs related to NDUFV2 Antibody (NBP1-84475).

Blogs on NDUFV2

There are no specific blogs for NDUFV2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFV2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFV2