NDUFS2 Antibody

Images

 
Western Blot: NDUFS2 Antibody [NBP2-30413] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: NDUFS2 Antibody [NBP2-30413] - Immunofluorescent staining of human cell line HeLa shows localization to mitochondria.
Immunohistochemistry: NDUFS2 Antibody [NBP2-30413] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFS2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFS2 Protein (NBP2-30413PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFS2 Antibody

  • CI-49
  • CI-49kD
  • complex 1, mitochondrial respiratory chain, 49-KD subunit
  • complex I 49kDa subunit
  • Complex I-49kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2 (49kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
  • NADH-ubiquinone oxidoreductase 49 kDa subunit
  • NADH-ubiquinone oxidoreductase NDUFS2 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
H00374291-P01
Species: Hu
NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31465
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP1-84475
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-39020
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-59560
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-03825
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
AF3014
Species: Hu
Applications: WB, IHC, Block
H00004700-R01
Species: Hu
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004704-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92171
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF

Publications for NDUFS2 Antibody (NBP2-30413) (0)

There are no publications for NDUFS2 Antibody (NBP2-30413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS2 Antibody (NBP2-30413) (0)

There are no reviews for NDUFS2 Antibody (NBP2-30413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFS2 Antibody (NBP2-30413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFS2 Products

Bioinformatics Tool for NDUFS2 Antibody (NBP2-30413)

Discover related pathways, diseases and genes to NDUFS2 Antibody (NBP2-30413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS2 Antibody (NBP2-30413)

Discover more about diseases related to NDUFS2 Antibody (NBP2-30413).
 

Pathways for NDUFS2 Antibody (NBP2-30413)

View related products by pathway.

PTMs for NDUFS2 Antibody (NBP2-30413)

Learn more about PTMs related to NDUFS2 Antibody (NBP2-30413).
 

Research Areas for NDUFS2 Antibody (NBP2-30413)

Find related products by research area.

Blogs on NDUFS2

There are no specific blogs for NDUFS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFS2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS2
Uniprot