NDUFS2 Antibody


Western Blot: NDUFS2 Antibody [NBP2-30413] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunocytochemistry/ Immunofluorescence: NDUFS2 Antibody [NBP2-30413] - Immunofluorescent staining of human cell line HeLa shows localization to mitochondria.
Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining of human heart muscle shows high expression.
Immunohistochemistry-Paraffin: NDUFS2 Antibody [NBP2-30413] - Staining in human heart muscle and pancreas tissues using anti-NDUFS2 antibody. Corresponding NDUFS2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NDUFS2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLD
Specificity of human NDUFS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
NDUFS2 Lysate (NBP2-65942)
Control Peptide
NDUFS2 Protein (NBP2-30413PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NDUFS2 Antibody

  • CI-49
  • CI-49kD
  • complex 1, mitochondrial respiratory chain, 49-KD subunit
  • complex I 49kDa subunit
  • Complex I-49kD
  • EC
  • EC
  • EC
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2 (49kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
  • NADH-ubiquinone oxidoreductase 49 kDa subunit
  • NADH-ubiquinone oxidoreductase NDUFS2 subunit


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, RNAi
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, IHC, Block
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NDUFS2 Antibody (NBP2-30413) (0)

There are no publications for NDUFS2 Antibody (NBP2-30413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS2 Antibody (NBP2-30413) (0)

There are no reviews for NDUFS2 Antibody (NBP2-30413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFS2 Antibody (NBP2-30413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional NDUFS2 Products

Bioinformatics Tool for NDUFS2 Antibody (NBP2-30413)

Discover related pathways, diseases and genes to NDUFS2 Antibody (NBP2-30413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS2 Antibody (NBP2-30413)

Discover more about diseases related to NDUFS2 Antibody (NBP2-30413).

Pathways for NDUFS2 Antibody (NBP2-30413)

View related products by pathway.

PTMs for NDUFS2 Antibody (NBP2-30413)

Learn more about PTMs related to NDUFS2 Antibody (NBP2-30413).

Research Areas for NDUFS2 Antibody (NBP2-30413)

Find related products by research area.

Blogs on NDUFS2

There are no specific blogs for NDUFS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFS2 Antibody and receive a gift card or discount.


Gene Symbol NDUFS2