NDUFB8 Antibody - Azide and BSA Free

Western Blot: NDUFB8 Antibody [NBP3-16016] - Western blot analysis of extracts of various cell lines, using NDUFB8 antibody (NBP3-16016) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: NDUFB8 Antibody [NBP3-16016] - Immunofluorescence analysis of U2OS cells using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: NDUFB8 Antibody [NBP3-16016] - Immunohistochemistry of paraffin-embedded mouse kidney using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: NDUFB8 Antibody [NBP3-16016] - Immunofluorescence analysis of A-549 cells using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: NDUFB8 Antibody [NBP3-16016] - Immunofluorescence analysis of NIH/3T3 cells using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: NDUFB8 Antibody [NBP3-16016] - Immunohistochemistry of paraffin-embedded human liver using NDUFB8 Rabbit pAb (NBP3-16016) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NDUFB8 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFB8 Antibody - Azide and BSA Free (NBP3-16016) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-186 of human NDUFB8 (NP_004995.1). ASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGMGYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFMIFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:100 - 1:500
• Theoretical MW: 22 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NDUFB8 Antibody - Azide and BSA Free

• CI-ASHImitochondrial
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI)
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa
• NADH:ubiquinone oxidoreductase ASHI subunit
• NADH-ubiquinone oxidoreductase ASHI subunit

Background

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: NDUFB8