NDUFB10 Antibody [Allophycocyanin]

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Allophycocyanin

NDUFB10 Antibody [Allophycocyanin] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-172 of human NDUFB10 (NP_004539.1).
  
  Sequence:
  MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFB10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: PBS
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDUFB10 Antibody [Allophycocyanin]

• CI-PDSW
• complex I PDSW subunit
• Complex I-PDSW
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10 (22kD, PDSW)
• NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 10, 22kDa
• NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
• NADH ubiquinone oxidoreductase PDSW subunit (RH 16p13.3)
• NADH-ubiquinone oxidoreductase PDSW subunit
• PDSW

Background

NDUFB10 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Complex I is composed of 45 different subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFB10