KBTBD10 Antibody - BSA Free

Western Blot: KBTBD10 Antibody [NBP1-80786] - Analysis in control (vector only transfected HEK293T lysate) and KLHL41 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: KBTBD10 Antibody [NBP1-80786] - Staining of human cell line A-431 shows positivity in nucleus, plasma membrane and cytoplasm.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human colon.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human skeletal muscle shows high expression.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining in human skeletal muscle and liver tissues using anti-KLHL41 antibody. Corresponding KLHL41 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human colon, liver, lymph node and skeletal muscle using Anti-KLHL41 antibody NBP1-80786 (A) shows similar protein distribution across tissues to independent antibody NBP1-80787 (B).

Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KBTBD10 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GDKSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQD
• Predicted Species: Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KBTBD10
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KBTBD10 Protein (NBP1-80786PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KBTBD10 Antibody - BSA Free

• FLJ60989
• kelch repeat and BTB (POZ) domain containing 10
• kelch repeat and BTB domain-containing protein 10
• Kelch-related protein 1
• Kel-like protein 23
• KRP1
• Sarcosin
• SARCOSINsarcomeric muscle protein

Background

KBTBD10 is required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KBTBD10 Antibody (NBP1-80786)(2)

Publications using NBP1-80786

• Akiba K, Hasegawa Y, Katoh-Fukui Y et al. POU1F1/Pou1f1 c.143-83A > G variant disrupts the branch site in pre-mRNA and leads dwarfism Endocrinology 2022-11-26 [PMID: 36427334] (ELISA, Mouse)
• Mukhi D, Kolligundla LP, Maruvada S et al. Growth hormone induces transforming growth factor-beta 1 in podocytes: Implications in podocytopathy and proteinuria Biochimica et biophysica acta. Molecular cell research 2022-11-15 [PMID: 36400249] (ELISA, Bovine)

Bioinformatics

• Gene Symbol: KBTBD10
• Entrez:
  • 10324(Human)