Western Blot: KBTBD10 Antibody [NBP1-80786] - Analysis in control (vector only transfected HEK293T lysate) and KLHL41 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: KBTBD10 Antibody [NBP1-80786] - Staining of human cell line A-431 shows positivity in nucleus, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human colon.
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human skeletal muscle shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining in human skeletal muscle and liver tissues using anti-KLHL41 antibody. Corresponding KLHL41 RNA-seq data are ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human colon, liver, lymph node and skeletal muscle using Anti-KLHL41 antibody NBP1-80786 (A) shows similar ...read more
Immunohistochemistry-Paraffin: KBTBD10 Antibody [NBP1-80786] - Staining of human lymph node.
This antibody was developed against Recombinant Protein corresponding to amino acids: GDKSLPCHRLILSACSPYFREYFLSEIDEAKKKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQD
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KBTBD10
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for KBTBD10 Antibody - BSA Free
FLJ60989
kelch repeat and BTB (POZ) domain containing 10
kelch repeat and BTB domain-containing protein 10
Kelch-related protein 1
Kel-like protein 23
KRP1
Sarcosin
SARCOSINsarcomeric muscle protein
Background
KBTBD10 is required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our KBTBD10 Antibody - BSA Free and receive a gift card or discount.