NDUFA9 Antibody


Western Blot: NDUFA9 Antibody [NBP2-57798] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: NDUFA9 Antibody [NBP2-57798] - Staining of human cell line RH-30 shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

NDUFA9 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGREDRFLNSFASMHRFGPIPL
Specificity of human NDUFA9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NDUFA9 Recombinant Protein Antigen (NBP2-57798PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NDUFA9 Antibody

  • CC6
  • CI39k
  • CI-39k
  • CI-39kD
  • complex I 39kDa subunit
  • Complex I-39kD
  • MGC111043
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
  • NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase)
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
  • NADH-ubiquinone oxidoreductase 39 kDa subunit
  • SDR22E1
  • short chain dehydrogenase/reductase family 22E, member 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IHC-WhMt
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP, In vivo, KD
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NDUFA9 Antibody (NBP2-57798) (0)

There are no publications for NDUFA9 Antibody (NBP2-57798).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA9 Antibody (NBP2-57798) (0)

There are no reviews for NDUFA9 Antibody (NBP2-57798). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDUFA9 Antibody (NBP2-57798) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NDUFA9 Products

Bioinformatics Tool for NDUFA9 Antibody (NBP2-57798)

Discover related pathways, diseases and genes to NDUFA9 Antibody (NBP2-57798). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA9 Antibody (NBP2-57798)

Discover more about diseases related to NDUFA9 Antibody (NBP2-57798).

Pathways for NDUFA9 Antibody (NBP2-57798)

View related products by pathway.

PTMs for NDUFA9 Antibody (NBP2-57798)

Learn more about PTMs related to NDUFA9 Antibody (NBP2-57798).

Research Areas for NDUFA9 Antibody (NBP2-57798)

Find related products by research area.

Blogs on NDUFA9

There are no specific blogs for NDUFA9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDUFA9 Antibody and receive a gift card or discount.


Gene Symbol NDUFA9