NDUFA9 Antibody - BSA Free

Western Blot: NDUFA9 Antibody [NBP2-13646] - Analysis in control (vector only transfected HEK293T lysate) and NDUFA9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: NDUFA9 Antibody [NBP2-13646] - Staining in human small intestine and pancreas tissues using anti-NDUFA9 antibody. Corresponding NDUFA9 RNA-seq data are presented for the same tissues.

Immunohistochemistry: NDUFA9 Antibody [NBP2-13646] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: NDUFA9 Antibody [NBP2-13646] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: NDUFA9 Antibody [NBP2-13646] - Staining of human small intestine shows high expression.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFA9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFA9 Antibody - BSA Free (NBP2-13646) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA9
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDUFA9 Protein (NBP2-13646PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NDUFA9 Antibody - BSA Free

• CC6
• CI39k
• CI-39k
• CI-39kD
• complex I 39kDa subunit
• Complex I-39kD
• MGC111043
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9 (39kD)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
• NADH dehydrogenase (ubiquinone) Fe-S protein 2-like (NADH-coenzyme Q reductase)
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
• NADH-ubiquinone oxidoreductase 39 kDa subunit
• NDUFS2L
• SDR22E1
• short chain dehydrogenase/reductase family 22E, member 1

Background

ATP is generated via oxidative phosphorylation (Oxphos) in the mitochondria of almost all cells. The protein components of Oxphos, 4 respiratory chain complexes (I-IV) and an ATP synthase, are encoded in both the mitochondrial and nuclear genomes. Of the 4 respiratory chain complexes, complex I is the largest at 900 kD and contains at least 41 polypeptide subunits, 7 of which are encoded in the mitochondria, the remaining subunits are encoded in the nucleus. The multisubunit NADH:ubiquinone oxidoreductase is the first enzyme complex. By use of chaotropic agents, complex I can be fragmented into 3 different fractions. The flavoprotein fraction contains the NDUFV1, NDUFV2, and NDUFV3 subunits. The iron-sulfur protein (IP) fraction contains at least 7 subunits, NDUFS1-NDUFS6 and NDUFA5. The remaining subunits are part of the hydrophobic protein (HP) fraction. NDUFA9 is part of the hydrophobic protein fraction of the enzyme complex. However, it is predominantly hydrophilic, and appears to lie mostly outside the lipid bilayer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA9