NDUFA2 Antibody

Images

 
Western Blot: NDUFA2 Antibody [NBP1-88968] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NDUFA2 Antibody [NBP1-88968] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFA2 Protein (NBP1-88968PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFA2 Antibody

  • B8
  • CD14
  • CIB8
  • CI-B8
  • complex I B8 subunit
  • Complex I-B8
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2 (8kD, B8)
  • NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa
  • NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
  • NADH-ubiquinone oxidoreductase B8 subunit
  • NADH-ubiquinone oxidoreductase subunit CI-B8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
870-LP/CF
Species: Hu
NB100-56722
Species: Hu, Ca
Applications: WB, B/N, Flow, Func, ICC/IF, IHC-P, IP, Flow-CS
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for NDUFA2 Antibody (NBP1-88968) (0)

There are no publications for NDUFA2 Antibody (NBP1-88968).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA2 Antibody (NBP1-88968) (0)

There are no reviews for NDUFA2 Antibody (NBP1-88968). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA2 Antibody (NBP1-88968) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFA2 Products

Bioinformatics Tool for NDUFA2 Antibody (NBP1-88968)

Discover related pathways, diseases and genes to NDUFA2 Antibody (NBP1-88968). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFA2 Antibody (NBP1-88968)

Discover more about diseases related to NDUFA2 Antibody (NBP1-88968).
 

Pathways for NDUFA2 Antibody (NBP1-88968)

View related products by pathway.

PTMs for NDUFA2 Antibody (NBP1-88968)

Learn more about PTMs related to NDUFA2 Antibody (NBP1-88968).

Blogs on NDUFA2

There are no specific blogs for NDUFA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFA2