NDUFA4 Antibody - BSA Free

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] - Immunofluorescence analysis of L929 cells using [KO Validated] NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Human liver using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: NDUFA4 Antibody [NBP3-37940] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: NDUFA4 Antibody [NBP3-37940] - Immunofluorescence analysis of U-2 OS cells using [KO Validated] NDUFA4 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Western Blot: NDUFA4 Antibody [NBP3-37940] - Western Blot analysis of lysates from wild type(WT) and NDUFA4 knockout (KO) 293T(KO) cells, using [KO Validated] NDUFA4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDUFA4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NDUFA4 Antibody - BSA Free (NBP3-37940) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-81 of human NDUFA4 (NP_002480.1).
  
  Sequence:
  MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVDYSKLKKERPDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDUFA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 9 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NDUFA4 Antibody - BSA Free

• CI-9k
• CI-MLRQ
• Complex I 9kDa subunit
• Complex I-MLRQ
• FLJ27440
• MGC104422
• MGC126843
• MGC126845
• MLRQ
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4 (9kD, MLRQ)
• NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4, 9kDa
• NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4
• NADH-ubiquinone oxidoreductase MLRQ subunit

Background

NDUFA4 is encoded by this gene belongs to the complex I 9kDa subunit family. Mammalian complex I of mitochondrial respiratory chain is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NDUFA4