Novus Biologicals products are now on bio-techne.com

NDUFC2 Antibody

Images

 
Western Blot: NDUFC2 Antibody [NBP1-88934] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
Immunohistochemistry: NDUFC2 Antibody [NBP1-88934] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Simple Western: NDUFC2 Antibody [NBP1-88934] - Simple Western lane view shows a specific band for NDUFC2 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing ...read more
Simple Western: NDUFC2 Antibody [NBP1-88934] - Electropherogram image of the corresponding Simple Western lane view. NDUFC2 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Simple Western 1:10
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
NDUFC2 Protein (NBP1-88934PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFC2 Antibody

  • B14.5b
  • CI-B14.5b
  • complex I subunit B14.5b
  • Complex I-B14.5b
  • HLC-1NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2 (14.5kD, B14.5b)
  • Human lung cancer oncogene 1 protein
  • NADH dehydrogenase (ubiquinone) 1, subcomplex unknown, 2, 14.5kDa
  • NADH dehydrogenase [ubiquinone] 1 subunit C2
  • NADHDH2
  • NADH-ubiquinone oxidoreductase subunit B14.5b

Background

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1048
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-72909
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-90050
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85571
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-82991
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
MAB3934
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-49127
Species: Hu
Applications: IHC, IHC-P
NBP1-32146
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45831
Species: Hu, Mu, Rt
Applications: IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-17014
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
NBP3-05606
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for NDUFC2 Antibody (NBP1-88934) (0)

There are no publications for NDUFC2 Antibody (NBP1-88934).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFC2 Antibody (NBP1-88934) (0)

There are no reviews for NDUFC2 Antibody (NBP1-88934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFC2 Antibody (NBP1-88934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFC2 Products

Research Areas for NDUFC2 Antibody (NBP1-88934)

Find related products by research area.

Blogs on NDUFC2

There are no specific blogs for NDUFC2, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFC2