Eva-1 Homolog C Antibody


Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human rectum shows low expression as expected.
Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules and glomeruli.
Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human gallbladder shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining in human gallbladder and rectum tissues using anti-EVA1C antibody. Corresponding EVA1C RNA-seq data are presented ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Eva-1 Homolog C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 28324027). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Eva-1 Homolog C Recombinant Protein Antigen (NBP1-88937PEP)
Read Publication using NBP1-88937.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Eva-1 Homolog C Antibody

  • B18
  • B19
  • C21orf63
  • C21orf64
  • chromosome 21 open reading frame 63
  • chromosome 21 open reading frame 64
  • EVA1
  • EVA-1
  • hypothetical protein LOC59271
  • PRED34
  • SUE21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for Eva-1 Homolog C Antibody (NBP1-88937)(1)

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Eva-1 Homolog C Antibody (NBP1-88937) (0)

There are no reviews for Eva-1 Homolog C Antibody (NBP1-88937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Eva-1 Homolog C Antibody (NBP1-88937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Eva-1 Homolog C Products

Bioinformatics Tool for Eva-1 Homolog C Antibody (NBP1-88937)

Discover related pathways, diseases and genes to Eva-1 Homolog C Antibody (NBP1-88937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Eva-1 Homolog C

There are no specific blogs for Eva-1 Homolog C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Eva-1 Homolog C Antibody and receive a gift card or discount.


Gene Symbol EVA1C