Eva-1 Homolog C Antibody

Immunohistochemistry-Paraffin: Eva-1 Homolog C Antibody [NBP1-88937] - c21orf63 Antibody [NBP1-88937] - Staining in human gallbladder and rectum tissues using anti-EVA1C antibody. Corresponding EVA1C RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human rectum shows low expression as expected.

Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human gallbladder shows high expression.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Eva-1 Homolog C Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EVA1C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 28324027). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Eva-1 Homolog C Recombinant Protein Antigen (NBP1-88937PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Eva-1 Homolog C Antibody

• B18
• B19
• C21orf63
• C21orf64
• chromosome 21 open reading frame 63
• chromosome 21 open reading frame 64
• EVA1
• EVA-1
• hypothetical protein LOC59271
• PRED34
• SUE21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Eva-1 Homolog C Antibody (NBP1-88937)(1)

Publication using NBP1-88937

• Singh R, Braga M, Reddy ST et al. Follistatin Targets Distinct Pathways To Promote Brown Adipocyte Characteristics in Brown and White Adipose Tissues. Endocrinology 2017-05-01 [PMID: 28324027] (WB)

Bioinformatics

• Gene Symbol: EVA1C