Magmas Antibody

Images

 
Western Blot: Magmas Antibody [NBP1-98528] - Hela, Antibody Dilution: 1.0 ug/ml PAM16 is supported by BioGPS gene expression data to be expressed in HeLa.
Western Blot: Magmas Antibody [NBP1-98528] - Titration: 1.0 ug/ml Positive Control: HepG2 Whole Cell.
Western Blot: Magmas Antibody [NBP1-98528] - Jurkat, Antibody Dilution: 1.0 ug/ml PAM16 is supported by BioGPS gene expression data to be expressed in Jurkat.

Product Details

Summary
Reactivity Hu, Mu, Rt, Po, CaSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Magmas Antibody Summary

Immunogen
The immunogen for this antibody is Magmas - C-terminal region. Peptide sequence NYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAM16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Magmas Antibody

  • MAGMAS
  • mitochondria associated protein involved in granulocyte macrophage colonystimulating factor signal transduction
  • Mitochondria-associated granulocyte macrophage CSF-signaling molecule
  • mitochondrial import inner membrane translocase subunit TIM16
  • presequence translocase-associated motor 16 homolog (S. cerevisiae)
  • Presequence translocated-associated motor subunit PAM16
  • Tim16
  • TIMM16magmas-like protein

Background

PAM16 regulates ATP-dependent protein translocation into the mitochondrial matrix and inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87346
Species: Hu
Applications: IHC, IHC-P
NBP1-86941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56929
Species: Hu, Mu, Rt, Bv, Gt, GP
Applications: WB, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67817
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-97841
Species: Hu
Applications: IP (-), WB
7954-GM/CF
Species: Hu
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
NBP2-34075
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
7954-GM/CF
Species: Hu
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-69571
Species: Hu, Mu, Rt, Bv, Ca, Eq, Gt, GP, Rb
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF755
Species: Mu
Applications: WB, Block
NBP1-98528
Species: Hu, Mu, Rt, Po, Ca
Applications: WB

Publications for Magmas Antibody (NBP1-98528) (0)

There are no publications for Magmas Antibody (NBP1-98528).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Magmas Antibody (NBP1-98528) (0)

There are no reviews for Magmas Antibody (NBP1-98528). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Magmas Antibody (NBP1-98528) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Magmas Products

Bioinformatics Tool for Magmas Antibody (NBP1-98528)

Discover related pathways, diseases and genes to Magmas Antibody (NBP1-98528). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Magmas Antibody (NBP1-98528)

Discover more about diseases related to Magmas Antibody (NBP1-98528).
 

Pathways for Magmas Antibody (NBP1-98528)

View related products by pathway.

PTMs for Magmas Antibody (NBP1-98528)

Learn more about PTMs related to Magmas Antibody (NBP1-98528).

Blogs on Magmas

There are no specific blogs for Magmas, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Magmas Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAM16
Uniprot