STK38 Antibody (2G8-1F3)

Images

 
Western Blot: STK38 Antibody (2G8-1F3) [H00011329-M01] - STK38 monoclonal antibody (M01), clone 2G8-1F3. Analysis of STK38 expression in human kidney.
Immunocytochemistry/ Immunofluorescence: STK38 Antibody (2G8-1F3) [H00011329-M01] - Analysis of monoclonal antibody to STK38 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: STK38 Antibody (2G8-1F3) [H00011329-M01] - Analysis of monoclonal antibody to STK38 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue Antibody ...read more
Western Blot: STK38 Antibody (2G8-1F3) [H00011329-M01] - STK38 monoclonal antibody (M01), clone 2G8-1F3 Analysis of STK38 expression in Hela S3 NE.
Western Blot: STK38 Antibody (2G8-1F3) [H00011329-M01] - Analysis of STK38 expression in transfected 293T cell line by STK38 monoclonal antibody (M01), clone 2G8-1F3.Lane 1: STK38 transfected lysate(54.2 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: STK38 Antibody (2G8-1F3) [H00011329-M01] - STK38 ( Cat# H00011329-M01 ) on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 ug/ml]
Immunoprecipitation: STK38 Antibody (2G8-1F3) [H00011329-M01] - Analysis of STK38 transfected lysate using anti-STK38 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STK38 MaxPab rabbit ...read more
Sandwich ELISA: STK38 Antibody (2G8-1F3) [H00011329-M01] - Detection limit for recombinant GST tagged STK38 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-P, IP
Clone
2G8-1F3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

STK38 Antibody (2G8-1F3) Summary

Immunogen
STK38 (AAH12085, 1 a.a. ~ 466 a.a) full length recombinant protein with GST tag. MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEF
Localization
Cytoplasmic and Nuclear
Specificity
STK38 - serine/threonine kinase 38
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STK38
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
Application Notes
Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Positive Control
STK38 Lysate (NBP2-64733)
Publications
Read Publication using H00011329-M01.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
Phosphate buffered saline, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for STK38 Antibody (2G8-1F3)

  • EC 2.7.11
  • EC 2.7.11.1
  • Ndr Ser/Thr kinase-like protein
  • NDR1 protein kinase
  • NDR1
  • NDRnuclear Dbf2-related 1
  • Nuclear Dbf2-related kinase 1
  • serine threonine protein kinase
  • serine/threonine kinase 38
  • serine/threonine-protein kinase 38

Background

STK38 belongs to the NDR family of serine/threonine protein kinases. NDR kinases require the phosphorylation of conserved Ser/Thr residues for activation. NDR family members have two unique stretches of primary sequence: an N-terminal regulatory (NTR) domain and an insert of several residues between subdomains VII and VIII of the kinase domain. The kinase domain insert functions as an auto-inhibitory sequence (AIS), while binding of the co-activator MOB (Mps-one binder) proteins to the NTR domain releases NDR kinases from inhibition of autophosphorylation. STK38 negatively regulates the activation of MEKK1/2 by direct interaction with the catalytic domain of MEKK1/2. The negative regulation of MEKK1/2 is not due to its phosphorylation by STK38.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45983
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NBP1-92435
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61873
Species: Hu
Applications: WB, ELISA, Flow, IHC
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02715
Species: Hu
Applications: WB, IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-91978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14535
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-197
Species: Hu, Mu
Applications: WB, IP
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02082
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006187-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-66121
Species: Hu
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE

Publications for STK38 Antibody (H00011329-M01)(1)


Reviews for STK38 Antibody (H00011329-M01) (0)

There are no reviews for STK38 Antibody (H00011329-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for STK38 Antibody (H00011329-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional STK38 Products

Bioinformatics Tool for STK38 Antibody (H00011329-M01)

Discover related pathways, diseases and genes to STK38 Antibody (H00011329-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK38 Antibody (H00011329-M01)

Discover more about diseases related to STK38 Antibody (H00011329-M01).
 

Pathways for STK38 Antibody (H00011329-M01)

View related products by pathway.

PTMs for STK38 Antibody (H00011329-M01)

Learn more about PTMs related to STK38 Antibody (H00011329-M01).
 

Research Areas for STK38 Antibody (H00011329-M01)

Find related products by research area.

Blogs on STK38

There are no specific blogs for STK38, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK38 Antibody (2G8-1F3) and receive a gift card or discount.

Bioinformatics

Gene Symbol STK38
Entrez
OMIM
Uniprot