NDRG3 Antibody

Images

 
Western Blot: NDRG3 Antibody [NBP1-86046] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: NDRG3 Antibody [NBP1-86046] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDRG3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CAKGWIDWAASKLSGLTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERPILGQNDNKSKTLKCSTLLVVGD
Specificity
Specificity of human, mouse NDRG3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDRG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB reported in scientific literature (PMID: 29096585). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDRG3 Protein (NBP1-86046PEP)
Publications
Read Publication using
NBP1-86046 in the following applications:

  • WB
    1 publication

Reactivity Notes

Rat (87%). Mouse reactivity reported in scientific literature (PMID: 29096585).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDRG3 Antibody

  • FLJ13556
  • NDRG family member 3
  • N-myc downstream-regulated gene 3
  • protein NDRG3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66969
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
H00057447-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA, KD
H00065009-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB600-335
Species: Hu, Mu, Ec, All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00011329-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP1-86745
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-74403
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP1-82591
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-79775
Species: Hu
Applications: WB, IHC, IHC-P, PA
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-80532
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-98528
Species: Hu
Applications: WB
NB100-65887
Species: Hu
Applications: Flow, IP
NBP1-77685
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for NDRG3 Antibody (NBP1-86046)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for NDRG3 Antibody (NBP1-86046) (0)

There are no reviews for NDRG3 Antibody (NBP1-86046). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDRG3 Antibody (NBP1-86046) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDRG3