NDRG2 Antibody

Images

 
Western Blot: NDRG2 Antibody [NBP1-55431] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: NDRG2 Antibody [NBP1-55431] - Human Liver tissue, 5 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDRG2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NDRG2(NDRG family member 2) The peptide sequence was selected from the C terminal of NDRG2. Peptide sequence GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDRG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against NDRG2 and was validated on Western blot.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NDRG2 Antibody

  • DKFZp781G1938
  • FLJ25522
  • KIAA1248cytoplasmic protein Ndr1
  • NDR1-related protein NDR2
  • NDRG family member 2
  • protein NDRG2
  • Protein Syld709613
  • syld709613 protein
  • SYLDN-myc downstream regulator 2

Background

NDRG2s gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. NDRG2 is a cytoplasmic protein that may play a role in neurite outgrowth. Its gene may be involved in glioblastoma carcinogenesis.This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that may play a role in neurite outgrowth. This gene may be involved in glioblastoma carcinogenesis. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-45983
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00065009-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-86046
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-19010
Species: Hu
Applications: WB, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
MAB5248
Species: Hu
Applications: IHC
NB100-56681
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC-P

Publications for NDRG2 Antibody (NBP1-55431) (0)

There are no publications for NDRG2 Antibody (NBP1-55431).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDRG2 Antibody (NBP1-55431) (0)

There are no reviews for NDRG2 Antibody (NBP1-55431). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDRG2 Antibody (NBP1-55431) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDRG2 Products

Bioinformatics Tool for NDRG2 Antibody (NBP1-55431)

Discover related pathways, diseases and genes to NDRG2 Antibody (NBP1-55431). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDRG2 Antibody (NBP1-55431)

Discover more about diseases related to NDRG2 Antibody (NBP1-55431).
 

Pathways for NDRG2 Antibody (NBP1-55431)

View related products by pathway.

PTMs for NDRG2 Antibody (NBP1-55431)

Learn more about PTMs related to NDRG2 Antibody (NBP1-55431).
 

Research Areas for NDRG2 Antibody (NBP1-55431)

Find related products by research area.

Blogs on NDRG2

There are no specific blogs for NDRG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDRG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDRG2