NDP52 Antibody


Western Blot: NDP52 Antibody [NBP1-87873] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: NDP52 Antibody [NBP1-87873] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

NDP52 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:YYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSD
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
NDP52 Protein (NBP1-87873PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NDP52 Antibody

  • Antigen nuclear dot 52 kDa protein
  • calcium binding and coiled-coil domain 2
  • calcium-binding and coiled-coil domain-containing protein 2
  • NDP52MGC17318
  • Nuclear domain 10 protein 52
  • Nuclear domain 10 protein NDP52
  • Nuclear dot protein 52


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P, Micro
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Species: Hu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, Block
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDP52 Antibody (NBP1-87873) (0)

There are no publications for NDP52 Antibody (NBP1-87873).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDP52 Antibody (NBP1-87873) (0)

There are no reviews for NDP52 Antibody (NBP1-87873). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDP52 Antibody (NBP1-87873). (Showing 1 - 1 of 1 FAQ).

  1. Is the same antigen used to make these antibodies: NBP1-87872, NBP1-87873, NBP1-87874. As it is used to make H00010241-M07 and H00010241-M05?
    • Different immunogens were used to make these antibodies. The sequences can be found on their datasheets.

Secondary Antibodies


Isotype Controls

Additional NDP52 Antibody Products

Related Products by Gene

Bioinformatics Tool for NDP52 Antibody (NBP1-87873)

Discover related pathways, diseases and genes to NDP52 Antibody (NBP1-87873). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDP52 Antibody (NBP1-87873)

Discover more about diseases related to NDP52 Antibody (NBP1-87873).

Pathways for NDP52 Antibody (NBP1-87873)

View related products by pathway.

Blogs on NDP52

There are no specific blogs for NDP52, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NDP52 Antibody and receive a gift card or discount.


Gene Symbol CALCOCO2

Customers Who Bought This Also Bought