NDP52 Antibody - BSA Free

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Analysis in human testis and pancreas tissues. Corresponding NDP52 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Staining of human gastrointestinal, kidney, pancreas and testis using Anti-NDP52 antibody NBP1-87873 (A) shows similar protein distribution across tissues to independent antibody NBP1-87874 (B).

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Analysis in control (vector only transfected HEK293T lysate) and CALCOCO2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NDP52 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CALCOCO2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NDP52 Protein (NBP1-87873PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NDP52 Antibody - BSA Free

• Antigen nuclear dot 52 kDa protein
• calcium binding and coiled-coil domain 2
• calcium-binding and coiled-coil domain-containing protein 2
• NDP52MGC17318
• Nuclear domain 10 protein 52
• Nuclear domain 10 protein NDP52
• Nuclear dot protein 52

Background

NDP52 is encoded by this gene is a subunit of nuclear domain 10 (ND10) bodies. ND10 bodies are nuclear domains appearing immunohistochemically as ten dots per nucleus. They are believed to be associated with the nuclear matrix on the basis of their resistance to nuclease digestion and salt extraction. ND10 proteins are removed from the nucleus by herpes simplex virus-1 infection and may have a role in viral life cycles. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for NDP52 Antibody (NBP1-87873). (Showing 1 - 1 of 1 FAQ).

1. Is the same antigen used to make these antibodies: NBP1-87872, NBP1-87873, NBP1-87874. As it is used to make H00010241-M07 and H00010241-M05?
   • Different immunogens were used to make these antibodies. The sequences can be found on their datasheets.

Bioinformatics

• Gene Symbol: CALCOCO2