NDP52 Antibody

Images

 
Western Blot: NDP52 Antibody [NBP1-87873] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: NDP52 Antibody [NBP1-87873] - Staining of human cell line U-2 OS shows positivity in vesicles.
Immunohistochemistry-Paraffin: NDP52 Antibody [NBP1-87873] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

NDP52 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CALCOCO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
NDP52 Protein (NBP1-87873PEP)

Alternate Names for NDP52 Antibody

  • Antigen nuclear dot 52 kDa protein
  • calcium binding and coiled-coil domain 2
  • calcium-binding and coiled-coil domain-containing protein 2
  • NDP52MGC17318
  • Nuclear domain 10 protein 52
  • Nuclear domain 10 protein NDP52
  • Nuclear dot protein 52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008878-M01
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31381
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02627
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Mu, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006672-D01P
Species: Hu, Mu
Applications: WB, ELISA
NB100-59787
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB600-975
Species: Hu
Applications: WB
NB110-40591
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-66520
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88883
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
NBP2-30003
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP
AF3014
Species: Hu
Applications: WB, IHC, Block
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-87873
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NDP52 Antibody (NBP1-87873) (0)

There are no publications for NDP52 Antibody (NBP1-87873).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDP52 Antibody (NBP1-87873) (0)

There are no reviews for NDP52 Antibody (NBP1-87873). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NDP52 Antibody (NBP1-87873). (Showing 1 - 1 of 1 FAQ).

  1. Is the same antigen used to make these antibodies: NBP1-87872, NBP1-87873, NBP1-87874. As it is used to make H00010241-M07 and H00010241-M05?
    • Different immunogens were used to make these antibodies. The sequences can be found on their datasheets.

Secondary Antibodies

 

Isotype Controls

Additional NDP52 Antibody Products

Related Products by Gene

Bioinformatics Tool for NDP52 Antibody (NBP1-87873)

Discover related pathways, diseases and genes to NDP52 Antibody (NBP1-87873). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDP52 Antibody (NBP1-87873)

Discover more about diseases related to NDP52 Antibody (NBP1-87873).
 

Pathways for NDP52 Antibody (NBP1-87873)

View related products by pathway.

Blogs on NDP52

There are no specific blogs for NDP52, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol CALCOCO2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-87873 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought