NDC80 Antibody

Immunocytochemistry/Immunofluorescence: NDC80 Antibody [42000002] - This image is specific to animal number SDQ2956 1:1000; Methanol fixation; 1 hr

Immunocytochemistry/Immunofluorescence: NDC80 Antibody [42000002] - This image is specific to animal number SDQ2941 1:1000; Methanol fixation; 1 hr

Product Discontinued

NDC80 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment
• Epitope: NKIELQKQIHGLTGKEVRQMNLDNNKDKEVVLEIQSELDRLSKETWKLKDEDFFKEQKSKFIHLAEQIMKILSGLNIQMNLEPLRAPTNERDLKDYWETL
• Specificity: Caenorhabditis elegans NDC80
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDC80
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
• Application Notes: This product is useful for ELISA and for Immunofluorescence. Use in Immunohistochemistry reported in scientific literature (PMID 25898113)

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for NDC80 Antibody

• HEC1KNTC2
• HECRetinoblastoma-associated protein HEC
• Highly expressed in cancer protein
• highly expressed in cancer, rich in leucine heptad repeats (yeast)
• highly expressed in cancer, rich in leucine heptad repeats
• hsHec1
• hsNDC80
• kinetochore associated 2
• Kinetochore protein Hec1
• kinetochore protein NDC80 homolog
• Kinetochore-associated protein 2
• NDC80 homolog, kinetochore complex component (S. cerevisiae)
• TID3

Background

HEC is one of several proteins involved in spindle checkpoint signaling. This surveillance mechanism assures correct segregation of chromosomes during cell division by detecting unaligned chromosomes and causing prometaphase arrest until the proper bipolar attachment of chromosomes is achieved.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NDC80 Antibody (42000002)(3)

Publications using 42000002

• Lawrence KS, Chau T, Engebrecht J. DNA Damage Response and Spindle Assembly Checkpoint Function throughout the Cell Cycle to Ensure Genomic Integrity PLoS Genet. 2015-04-01 [PMID: 25898113] (IF/IHC, C. elegans)
• Fabig G, Kiewisz R, Lindow N et al. Male meiotic spindle features that efficiently segregate paired and lagging chromosomes BioRxiv (ICC/IF)
• Fabig G, Kiewisz R, Lindow N et al. Male meiotic spindle features that efficiently segregate paired and lagging chromosomes Elife 2020-03-10 [PMID: 32149606]

Bioinformatics

• Gene Symbol: NDC80
• Entrez:
  • 177873(C. elegans)
• Uniprot:
  • Q17635(C. elegans)