NDC80 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NDC80 Antibody [42000002] - This image is specific to animal number SDQ2956 1:1000; Methanol fixation; 1 hr
Immunocytochemistry/ Immunofluorescence: NDC80 Antibody [42000002] - This image is specific to animal number SDQ2941 1:1000; Methanol fixation; 1 hr

Product Details

Summary
Reactivity CeSpecies Glossary
Applications ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

NDC80 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
NKIELQKQIHGLTGKEVRQMNLDNNKDKEVVLEIQSELDRLSKETWKLKDEDFFKEQKSKFIHLAEQIMKILSGLNIQMNLEPLRAPTNERDLKDYWETL
Specificity
Caenorhabditis elegans NDC80
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDC80
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
  • Immunohistochemistry
Application Notes
This product is useful for ELISA and for Immunofluorescence. Use in Immunohistochemistry reported in scientific literature (PMID 25898113)
Publications
Read Publication using
42000002 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for NDC80 Antibody

  • HEC1KNTC2
  • HECRetinoblastoma-associated protein HEC
  • Highly expressed in cancer protein
  • highly expressed in cancer, rich in leucine heptad repeats (yeast)
  • highly expressed in cancer, rich in leucine heptad repeats
  • hsHec1
  • hsNDC80
  • kinetochore associated 2
  • Kinetochore protein Hec1
  • kinetochore protein NDC80 homolog
  • Kinetochore-associated protein 2
  • NDC80 homolog, kinetochore complex component (S. cerevisiae)
  • TID3

Background

HEC is one of several proteins involved in spindle checkpoint signaling. This surveillance mechanism assures correct segregation of chromosomes during cell division by detecting unaligned chromosomes and causing prometaphase arrest until the proper bipolar attachment of chromosomes is achieved.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31632
Species: Hu
Applications: WB, ICC/IF
NBP2-47264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NBP2-47263
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4185
Species: Hu
Applications: ICC
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2586
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB110-40681
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55474
Species: Hu
Applications: ICC/IF
AF6028
Species: Hu
Applications: WB, IHC
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
42000002
Species: Ce
Applications: ELISA, ICC/IF, IHC
Supplier Logo

Publications for NDC80 Antibody (42000002)(1)

We have publications tested in 1 confirmed species: C. elegans.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
C. elegans
(1)
All Species

Reviews for NDC80 Antibody (42000002) (0)

There are no reviews for NDC80 Antibody (42000002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NDC80 Antibody (42000002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDC80 Products

Bioinformatics Tool for NDC80 Antibody (42000002)

Discover related pathways, diseases and genes to NDC80 Antibody (42000002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDC80 Antibody (42000002)

Discover more about diseases related to NDC80 Antibody (42000002).
 

Pathways for NDC80 Antibody (42000002)

View related products by pathway.

PTMs for NDC80 Antibody (42000002)

Learn more about PTMs related to NDC80 Antibody (42000002).
 

Research Areas for NDC80 Antibody (42000002)

Find related products by research area.

Blogs on NDC80

There are no specific blogs for NDC80, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDC80 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDC80
Entrez
Uniprot