NCOA7 Antibody


Immunohistochemistry-Paraffin: NCOA7 Antibody [NBP1-85202] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

NCOA7 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NDVELKGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENLQKTELSDG
Specificity of human NCOA7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NCOA7 Protein (NBP1-85202PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NCOA7 Antibody

  • 140 kDa estrogen receptor-associated protein
  • dJ187J11.3
  • ERAP140Nbla00052
  • ESNA1
  • Estrogen nuclear receptor coactivator 1
  • estrogen receptor associated protein 140 kDa
  • FLJ45605
  • MGC88425
  • Nbla10993
  • nuclear receptor coactivator 7
  • putative protein product of Nbla00052
  • putative protein product of Nbla10993


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu
Species: Hu
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for NCOA7 Antibody (NBP1-85202) (0)

There are no publications for NCOA7 Antibody (NBP1-85202).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA7 Antibody (NBP1-85202) (0)

There are no reviews for NCOA7 Antibody (NBP1-85202). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NCOA7 Antibody (NBP1-85202) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NCOA7 Products

Bioinformatics Tool for NCOA7 Antibody (NBP1-85202)

Discover related pathways, diseases and genes to NCOA7 Antibody (NBP1-85202). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA7 Antibody (NBP1-85202)

Discover more about diseases related to NCOA7 Antibody (NBP1-85202).

Pathways for NCOA7 Antibody (NBP1-85202)

View related products by pathway.

PTMs for NCOA7 Antibody (NBP1-85202)

Learn more about PTMs related to NCOA7 Antibody (NBP1-85202).

Blogs on NCOA7

There are no specific blogs for NCOA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NCOA7 Antibody and receive a gift card or discount.


Gene Symbol NCOA7