NCOA7 Antibody

Images

 
Immunohistochemistry: NCOA7 Antibody [NBP1-85202] - Staining of human cerebral cortex shows strong nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NCOA7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NDVELKGALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENLQKTELSDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCOA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NCOA7 Protein (NBP1-85202PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCOA7 Antibody

  • 140 kDa estrogen receptor-associated protein
  • dJ187J11.3
  • ERAP140Nbla00052
  • ESNA1
  • Estrogen nuclear receptor coactivator 1
  • estrogen receptor associated protein 140 kDa
  • FLJ45605
  • MGC88425
  • Nbla10993
  • nuclear receptor coactivator 7
  • putative protein product of Nbla00052
  • putative protein product of Nbla10993

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-86391
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
H00085329-T01
Species: Hu
H00005956-R02
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85202
Species: Hu
Applications: IHC, IHC-P

Publications for NCOA7 Antibody (NBP1-85202) (0)

There are no publications for NCOA7 Antibody (NBP1-85202).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA7 Antibody (NBP1-85202) (0)

There are no reviews for NCOA7 Antibody (NBP1-85202). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NCOA7 Antibody (NBP1-85202) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCOA7 Products

Bioinformatics Tool for NCOA7 Antibody (NBP1-85202)

Discover related pathways, diseases and genes to NCOA7 Antibody (NBP1-85202). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA7 Antibody (NBP1-85202)

Discover more about diseases related to NCOA7 Antibody (NBP1-85202).
 

Pathways for NCOA7 Antibody (NBP1-85202)

View related products by pathway.

PTMs for NCOA7 Antibody (NBP1-85202)

Learn more about PTMs related to NCOA7 Antibody (NBP1-85202).

Blogs on NCOA7

There are no specific blogs for NCOA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCOA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA7