OXR1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit OXR1 Antibody - BSA Free (NBP1-86391) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EEYGIMCPMEEVMSAAMYKEILDSKIKESLPIDIDQLSGRDFCHSKKMTGSNTEEIDSRIRDAGNDSASTAPRSTEESLSEDVFTESELSPIR |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
OXR1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for OXR1 Antibody - BSA Free
Background
Oxidation resistance 1 (OXR1) protein was originally identified in a screen for human genes that function to protect cells from oxidative damage. OXR1 localizes to the mitochondria, and its expression has been shown to be induced by heat and oxidative stress.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, KD, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA
Publications for OXR1 Antibody (NBP1-86391) (0)
There are no publications for OXR1 Antibody (NBP1-86391).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for OXR1 Antibody (NBP1-86391) (0)
There are no reviews for OXR1 Antibody (NBP1-86391).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for OXR1 Antibody (NBP1-86391) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional OXR1 Products
Blogs on OXR1