NCOA6 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NCOA6 Antibody [NBP1-89193] - Staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NCOA6 Antibody [NBP1-89193] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: NCOA6 Antibody [NBP1-89193] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: NCOA6 Antibody [NBP1-89193] - Staining in human testis and skeletal muscle tissues.. Corresponding NCOA6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NCOA6 Antibody [NBP1-89193] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NCOA6 Antibody [NBP1-89193] - Staining of human skeletal muscle shows weak nuclear positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NCOA6 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQ
• Predicted Species: Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCOA6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NCOA6 Protein (NBP1-89193PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NCOA6 Antibody - BSA Free

• Activating signal cointegrator 2
• AIB3NRC RAP250
• Amplified in breast cancer protein 3
• ASC-2
• Cancer-amplified transcriptional coactivator ASC-2
• KIAA0181PPAR-interacting protein
• NRCamplified in breast cancer-3 protein
• nuclear receptor coactivator 6
• Nuclear receptor coactivator RAP250
• Nuclear receptor-activating protein, 250 kDa
• peroxisome proliferator-activated receptor interacting protein
• PRIPPeroxisome proliferator-activated receptor-interacting protein
• RAP250Thyroid hormone receptor-binding protein
• thyroid hormone receptor binding protein
• TRBPASC2activating signal cointegrator-2

Background

Nuclear receptor coactivator that directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. Coactivates expression in an agonist- and AF2-dependent manner. Involved in the coactivation of different nuclear receptors, such as for steroids (GR and ERs), retinoids (RARs and RXRs), thyroid hormone (TRs), vitamin D3 (VDR) and prostanoids (PPARs). Probably functions as a general coactivator, rather than just a nuclear receptor coactivator. May also be involved in the coactivation of the NF-kappa-B pathway. May coactivate expression via a remodeling of chromatin and its interaction with histone acetyltransferase proteins. Involved in placental, cardiac, hepatic and embryonic development. NCOA6 is over-expressed in several breast cancer cell lines.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCOA6
• Entrez:
  • 56406(Mouse)
  • 116464(Rat)
• Uniprot:
  • Q14686(Human)