NCOA6 Antibody

Images

 
Western Blot: NCOA6 Antibody [NBP1-89193] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: HELA
Immunocytochemistry/ Immunofluorescence: NCOA6 Antibody [NBP1-89193] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: NCOA6 Antibody [NBP1-89193] - Staining of human kidney shows nuclear positivity in cells of tubules and glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NCOA6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSGVPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQMMVNPPSQNLGPSPQRMTPPKQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NCOA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NCOA6 Protein (NBP1-89193PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NCOA6 Antibody

  • Activating signal cointegrator 2
  • AIB3NRC RAP250
  • Amplified in breast cancer protein 3
  • ASC-2
  • Cancer-amplified transcriptional coactivator ASC-2
  • KIAA0181PPAR-interacting protein
  • NRCamplified in breast cancer-3 protein
  • nuclear receptor coactivator 6
  • Nuclear receptor coactivator RAP250
  • Nuclear receptor-activating protein, 250 kDa
  • peroxisome proliferator-activated receptor interacting protein
  • PRIPPeroxisome proliferator-activated receptor-interacting protein
  • RAP250Thyroid hormone receptor-binding protein
  • thyroid hormone receptor binding protein
  • TRBPASC2activating signal cointegrator-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP2-24725
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
MAB6967
Species: Hu
Applications: WB
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-87296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
NBP1-85806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NCOA6 Antibody (NBP1-89193) (0)

There are no publications for NCOA6 Antibody (NBP1-89193).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCOA6 Antibody (NBP1-89193) (0)

There are no reviews for NCOA6 Antibody (NBP1-89193). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCOA6 Antibody (NBP1-89193) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NCOA6 Products

Bioinformatics Tool for NCOA6 Antibody (NBP1-89193)

Discover related pathways, diseases and genes to NCOA6 Antibody (NBP1-89193). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCOA6 Antibody (NBP1-89193)

Discover more about diseases related to NCOA6 Antibody (NBP1-89193).
 

Pathways for NCOA6 Antibody (NBP1-89193)

View related products by pathway.

PTMs for NCOA6 Antibody (NBP1-89193)

Learn more about PTMs related to NCOA6 Antibody (NBP1-89193).
 

Research Areas for NCOA6 Antibody (NBP1-89193)

Find related products by research area.

Blogs on NCOA6.

ASC-2: An important co-activator of different nuclear receptors
ASC-2, also known as Nuclear Receptor Co-Activator 6, directly binds nuclear receptors and stimulates the transcriptional activities in a hormone-dependent fashion. It is involved in the co-activation of different nuclear receptors, such as for steroi...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NCOA6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NCOA6
Entrez
Uniprot