NCKIPSD Antibody


Western Blot: NCKIPSD Antibody [NBP2-56886] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: NCKIPSD Antibody [NBP2-56886] - Staining of human cell line HeLa shows localization to plasma membrane & cytosol.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF

Order Details

NCKIPSD Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP
Specificity of human NCKIPSD antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NCKIPSD Recombinant Protein Antigen (NBP2-56886PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for NCKIPSD Antibody

  • 54 kDa vimentin-interacting protein
  • 90 kDa SH3 protein interacting with Nck
  • AF3p21
  • AF3P21DIP-1
  • dia interacting protein
  • Dia-interacting protein 1
  • diaphanous protein interacting protein
  • Diaphanous protein-interacting protein
  • DIP
  • DIP1
  • MGC23891
  • NCK interacting protein with SH3 domain
  • ORF1
  • SPIN90VIP54
  • WASP-interacting SH3-domain protein
  • WISHSH3 adapter protein SPIN90
  • Wisk90 kDa


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF

Publications for NCKIPSD Antibody (NBP2-56886) (0)

There are no publications for NCKIPSD Antibody (NBP2-56886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCKIPSD Antibody (NBP2-56886) (0)

There are no reviews for NCKIPSD Antibody (NBP2-56886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCKIPSD Antibody (NBP2-56886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional NCKIPSD Products

Bioinformatics Tool for NCKIPSD Antibody (NBP2-56886)

Discover related pathways, diseases and genes to NCKIPSD Antibody (NBP2-56886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCKIPSD Antibody (NBP2-56886)

Discover more about diseases related to NCKIPSD Antibody (NBP2-56886).

Pathways for NCKIPSD Antibody (NBP2-56886)

View related products by pathway.

PTMs for NCKIPSD Antibody (NBP2-56886)

Learn more about PTMs related to NCKIPSD Antibody (NBP2-56886).

Blogs on NCKIPSD

There are no specific blogs for NCKIPSD, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NCKIPSD Antibody and receive a gift card or discount.


Gene Symbol NCKIPSD