ASZ1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ASZ1 Antibody [NBP1-89130] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ASZ1 Antibody [NBP1-89130] - Staining of human testis shows cytoplasmic positivity in cells of the seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ASZ1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASZ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASZ1 Protein (NBP1-89130PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ASZ1 Antibody

  • ALP1Germ cell-specific ankyrin, SAM and basic leucine zipper domain-containingprotein
  • ANKL14933400N19Rik
  • ankyrin repeat, SAM and basic leucine zipper domain containing 1
  • ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
  • ankyrin-like 1
  • Ankyrin-like protein 1
  • CT1.19
  • GASZC7orf7
  • MGC26634
  • Orf3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-63066
Species: Vi
Applications: ELISA, IP
NBP1-42664
Species: Hu
Applications: WB, IHC, IP
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32030
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP2-31977
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00009354-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-84943
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006904-B01
Species: Hu
Applications: WB

Publications for ASZ1 Antibody (NBP1-89130) (0)

There are no publications for ASZ1 Antibody (NBP1-89130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ASZ1 Antibody (NBP1-89130) (0)

There are no reviews for ASZ1 Antibody (NBP1-89130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ASZ1 Antibody (NBP1-89130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ASZ1 Products

Bioinformatics Tool for ASZ1 Antibody (NBP1-89130)

Discover related pathways, diseases and genes to ASZ1 Antibody (NBP1-89130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASZ1 Antibody (NBP1-89130)

Discover more about diseases related to ASZ1 Antibody (NBP1-89130).
 

Pathways for ASZ1 Antibody (NBP1-89130)

View related products by pathway.

Blogs on ASZ1

There are no specific blogs for ASZ1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ASZ1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASZ1