NCF4 Antibody

Immunocytochemistry/Immunofluorescence: NCF4 Antibody [NBP2-58290] - Staining of human cell line REH shows localization to cytosol.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

NCF4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCF4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NCF4 Recombinant Protein Antigen (NBP2-58290PEP)

Reactivity Notes

Mouse 88%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NCF4 Antibody

• MGC3810
• NCF
• NCF-4
• neutrophil cytosol factor 4
• neutrophil cytosolic factor 4 (40kD)
• neutrophil cytosolic factor 4, 40kDa
• Neutrophil NADPH oxidase factor 4
• p40phox
• p40-phox
• SH3 and PX domain-containing protein 4
• SH3PXD4P40PHOX

Background

The NADPH oxidase generates superoxide in phagocytic cells. It is important for immunity and its deficiency leads to chronic granulomatous disease (CGD) (1). p40-phox is a newly isolated cytosolic component of the nicotinamide adenine dinucleotide phosphate (NADPH)-oxidase that copurifies with p67-phox. Preliminary evidence indicates that it is a component of the cytosolic complex (2). Maximal activation of NADPH oxidase requires formation of a complex between the p40-phox and p67-phox subunits via association of their PB1 domains. The crystal structure of the p40-phox/p67phox PB1 heterodimer reveals that both domains have a beta grasp topology and that they bind in a front-to-back arrangement through conserved electrostatic interactions between an acidic OPCA motif on p40-phox and basic residues in p67-phox (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NCF4