p67phox/NOXA2 Antibody

Immunohistochemistry-Paraffin: p67phox/NOXA2 Antibody [NBP1-82542] - Analysis in human bone marrow and skeletal muscle tissues. Corresponding p67phox/NOXA2 RNA-seq data are presented for the same tissues.

Western Blot: p67phox/NOXA2 Antibody [NBP1-82542] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted)

Immunocytochemistry/Immunofluorescence: p67phox/NOXA2 Antibody [NBP1-82542] - Staining of human cell line U-251 MG shows localization to nucleoli and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: p67phox/NOXA2 Antibody [NBP1-82542] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: p67phox/NOXA2 Antibody [NBP1-82542] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Immunohistochemistry-Paraffin: p67phox/NOXA2 Antibody [NBP1-82542] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Immunohistochemistry-Paraffin: p67phox/NOXA2 Antibody [NBP1-82542] - Staining of human placenta shows moderate to strong cytoplasmic positivity in lymphoid cells.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

p67phox/NOXA2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQLAKKDYLGKATVVASVVDQDSFSGFAPLQPQAA
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  p67phox/NOXA2 Protein (NBP1-82542PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for p67phox/NOXA2 Antibody

• autosomal 2
• NADPH oxidase activator 2
• NCF2
• NCF-2
• neutrophil cytosol factor 2
• neutrophil cytosolic factor 2 (65kD, chronic granulomatous disease, autosomal2)
• neutrophil cytosolic factor 2
• NOXA2
• NOXA2FLJ93058
• p67phox
• p67-phox

Background

NOXA2 encodes neutrophil cytosolic factor 2, the 67-kilodalton cytosolic subunit of the multi-protein NADPH oxidase complex found in neutrophils. This oxidase produces a burst of superoxide which is delivered to the lumen of the neutrophil phagosome. Mutations in this gene, as well as in other NADPH oxidase subunits, can result in chronic granulomatous disease, a disease that causes recurrent infections by catalase-positive organisms. Alternative splicing results in two transcript variants that encode the same protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for p67phox/NOXA2 Antibody (NBP1-82542)(1)

Publication using NBP1-82542

• Lomnytska MI, Becker S, Bodin I et al. Differential expression of ANXA6, HSP27, PRDX2, NCF2, and TPM4 during uterine cervix carcinogenesis: diagnostic and prognostic value. Br J Cancer 2011-01-01 [PMID: 21119665]

Bioinformatics

• Gene Symbol: NCF2