NARFL Antibody - BSA Free

Western Blot: NARFL Antibody [NBP2-85357] - Host: Rabbit. Target Name: NARFL. Sample Type: ACHN Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NARFL Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NARFL Antibody - BSA Free (NBP2-85357) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human NARFL. Peptide sequence: MACPSGCLNGGGQLQAPDRPSRELLQHVERLYGMVRAEAPEDAPGVQELY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CIAO3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NARFL Antibody - BSA Free

• cytosolic Fe-S cluster assembly factor NARFL
• FLJ21988
• HPRN
• IOP1Protein related to Narf
• Iron-only hydrogenase-like protein 1
• LET1 like/JFP15
• Nuclear prelamin A recognition factor-like protein
• nuclear prelamin A recognition factor-like
• PRNLET1L

Background

NARFL is a component of the cytosolic iron-sulfur (Fe/S) protein assembly machinery. Required for maturation ofextramitochondrial Fe/S proteins. Seems to negatively regulate the level of HIF1A expression, although this effectcould be indirect

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CIAO3