Nab2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Nab2 Antibody - BSA Free (NBP3-38193) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Nab2 (NP_005958.1).
Sequence: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGE |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NAB2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Nab2 Antibody - BSA Free
Background
Transcriptional control is in part regulated by interactions between DNA-bound transcription factors, such as Egr-1/NGFI-A, and coregulatory proteins, such as NAB (for NGFI-A-binding proteins). The evolutionarily conserved NAB proteins, NAB1 and NAB2, are corepressors of EGF-1/NGFI-A. Both NAB1 and NAB2 contain an amino terminal NAB conserved domain 1 (NCB1), which is required for binding NGFI-A, and a carboxy terminal NCD2 domain, which is responsible for the repressor function of NAB proteins. NAB2 is principally localized in the nucleus and may play a role in the downregulation of NGFI-A activity as well as in controlling fundamental processes such as cell division, differentiation and apoptosis. NAB2 has a predicted molecular mass of 56 kDa and localizes to chromosome 12q13.3-14.1, a region that is rearranged in several solid tumors, lipomas and liposarcomas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: WB, ELISA
Publications for Nab2 Antibody (NBP3-38193) (0)
There are no publications for Nab2 Antibody (NBP3-38193).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nab2 Antibody (NBP3-38193) (0)
There are no reviews for Nab2 Antibody (NBP3-38193).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nab2 Antibody (NBP3-38193) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nab2 Products
Research Areas for Nab2 Antibody (NBP3-38193)
Find related products by research area.
|
Blogs on Nab2