EGR3 Antibody - BSA Free

Immunohistochemistry-Paraffin: EGR3 Antibody [NBP1-80903] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.

ChIP-Exo-Seq composite graph for Anti-EGR3 (NBP1-80903) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

EGR3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit EGR3 Antibody - BSA Free (NBP1-80903) is a polyclonal antibody validated for use in IHC. Anti-EGR3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EPVSFHDPQGNPGLAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSD
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EGR3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  EGR3 Protein (NBP1-80903PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23342084)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for EGR3 Antibody - BSA Free

• early growth response 3
• early growth response protein 3
• EGR-3
• MGC138484
• PILOTZinc finger protein pilot

Background

The gene encodes a transcriptional regulator that belongs to the EGR family of C2H2-type zinc-finger proteins. It is an immediate-early growth response gene which is induced by mitogenic stimulation. The protein encoded by this gene participates in the transcriptional regulation of genes in controling biological rhythm. It may also plays a role in muscle development. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EGR3 Antibody (NBP1-80903)(1)

Publication using NBP1-80903

• Pio R, Jia Z, Baron VT et al. Early Growth Response 3 (Egr3) Is Highly Over-Expressed in Non-Relapsing Prostate Cancer but Not in Relapsing Prostate Cancer. PLoS One 2013-01-01 [PMID: 23342084]

Bioinformatics

• Gene Symbol: EGR3
• Entrez:
  • 1960(Human)
• Uniprot:
  • Q06889(Human)