N myc interactor Antibody

Images

 
Western Blot: N myc interactor Antibody [NBP1-90374] - Analysis in control (vector only transfected HEK293T lysate) and nMI over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunocytochemistry/ Immunofluorescence: N myc interactor Antibody [NBP1-90374] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: N myc interactor Antibody [NBP1-90374] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

N myc interactor Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMI
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
N myc interactor Protein (NBP1-90374PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for N myc interactor Antibody

  • Nmi
  • N-myc (and STAT) interactor
  • N-myc and STAT interactor
  • N-myc interactor
  • N-myc-interactor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87745
Species: Hu
Applications: WB, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-01108
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
NBP2-46403
Species: Hu
Applications: IHC
NBL1-11664
Species: Hu
NBP2-07799
Species: Hu
NBP2-13443
Species: Hu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NB600-279
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-90374
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for N myc interactor Antibody (NBP1-90374) (0)

There are no publications for N myc interactor Antibody (NBP1-90374).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N myc interactor Antibody (NBP1-90374) (0)

There are no reviews for N myc interactor Antibody (NBP1-90374). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for N myc interactor Antibody (NBP1-90374) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N myc interactor Products

Bioinformatics Tool for N myc interactor Antibody (NBP1-90374)

Discover related pathways, diseases and genes to N myc interactor Antibody (NBP1-90374). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N myc interactor Antibody (NBP1-90374)

Discover more about diseases related to N myc interactor Antibody (NBP1-90374).
 

Pathways for N myc interactor Antibody (NBP1-90374)

View related products by pathway.

PTMs for N myc interactor Antibody (NBP1-90374)

Learn more about PTMs related to N myc interactor Antibody (NBP1-90374).
 

Research Areas for N myc interactor Antibody (NBP1-90374)

Find related products by research area.

Blogs on N myc interactor

There are no specific blogs for N myc interactor, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N myc interactor Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMI