Troponin T Type 3 (fast skeletal) Antibody - BSA Free

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Staining in human skeletal muscle and heart muscle tissues using anti-TNNT3 antibody. Corresponding ...read more
Western Blot: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Staining of human heart muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Troponin T Type 3 (fast skeletal) Antibody [NBP1-92534] - Staining of human skeletal muscle shows high expression.
Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Staining of human liver shows no positivity in hepatocytes as expected.
Staining of human heart muscle shows no cytoplasmic positivity in cardiomyocytes as expected.
Staining of human small intestine shows no positivity in glandular cells as expected.
Analysis in human cell line RT-4.
Orthogonal Strategies: Analysis in human skeletal muscle and heart muscle tissues using NBP1-92534 antibody. Corresponding TNNT3 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Troponin T Type 3 (fast skeletal) Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Troponin T Type 3 (fast skeletal) Antibody - BSA Free (NBP1-92534) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVG
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNNT3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Troponin T Type 3 (fast skeletal) Recombinant Protein Antigen (NBP1-92534PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Troponin T Type 3 (fast skeletal) Antibody - BSA Free

  • Beta-TnTF
  • fast skeletal muscle
  • TnTf
  • troponin T type 3 (skeletal, fast)
  • troponin T3, skeletal, fast
  • troponin-T3, skeletal, fast

Background

Cardiac Troponin T, a 36kDa protein, is the tropomyosin binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations within the protein have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for the gene undergo alternative splicing that results in many tissue specific isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00007138-B01P
Species: Hu, In
Applications: WB
NBP2-26200
Species: Hu, Mu, Po, Rt
Applications: PEP-ELISA, WB
NBP2-95197
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB120-11099
Species: Al, Am, Av, Bv, Ch, Fi, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, WB
NBP1-89707
Species: Hu
Applications: IHC,  IHC-P
NBP1-56641
Species: Hu, Mu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-55165
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-74340
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
H00007170-M02
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP2-55151
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-35336
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP2-02710
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-92149
Species: Hu
Applications: IHC,  IHC-P
NBP2-41309
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB

Publications for Troponin T Type 3 (fast skeletal) Antibody (NBP1-92534) (0)

There are no publications for Troponin T Type 3 (fast skeletal) Antibody (NBP1-92534).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Troponin T Type 3 (fast skeletal) Antibody (NBP1-92534) (0)

There are no reviews for Troponin T Type 3 (fast skeletal) Antibody (NBP1-92534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Troponin T Type 3 (fast skeletal) Antibody (NBP1-92534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Troponin T Type 3 (fast skeletal) Products

Research Areas for Troponin T Type 3 (fast skeletal) Antibody (NBP1-92534)

Find related products by research area.

Blogs on Troponin T Type 3 (fast skeletal)

There are no specific blogs for Troponin T Type 3 (fast skeletal), but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Troponin T Type 3 (fast skeletal) Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol TNNT3