Myomesin 2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Myomesin 2 Antibody - BSA Free (NBP1-87591) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: ERLMALSNEIKNPTIPLKSELAYEIFDKGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTYTVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVT |
| Predicted Species |
Mouse (92%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MYOM2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Myomesin 2 Antibody - BSA Free
Background
Myomesin-1 (190 kDa) and myomesin-2 (165 kDa) are components of the vertebrate myofibrillar M band and are associated with Titin, Myosin and Connectin. The myomesin proteins are responsible for the formation of a head structure on one end of the Titin string that connects the Z and M bands of the sarcomere. Myomesin-1 and -2 have unique N-terminal domains and are expressed mainly in skeletal muscle. The gene encoding human myomesin-1 maps to chromosome 18p11.31-p11.32.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Rt
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
Species: All-Multi
Applications: Flow, ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC
Publications for Myomesin 2 Antibody (NBP1-87591) (0)
There are no publications for Myomesin 2 Antibody (NBP1-87591).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myomesin 2 Antibody (NBP1-87591) (0)
There are no reviews for Myomesin 2 Antibody (NBP1-87591).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Myomesin 2 Antibody (NBP1-87591) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myomesin 2 Products
Blogs on Myomesin 2