Myomesin 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Myomesin 2 Antibody [NBP1-87496] - Immunofluorescent staining of human cell line HEK 293 shows localization to mitochondria.
Immunohistochemistry-Paraffin: Myomesin 2 Antibody [NBP1-87496] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Myomesin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYOM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20-1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Myomesin 2 Protein (NBP1-87496PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myomesin 2 Antibody

  • 165 kDa connectin-associated protein
  • 165 kDa titin-associated protein
  • M-band protein
  • M-protein
  • myomesin (M-protein) 2 (165kD)
  • myomesin (M-protein) 2, 165kDa
  • Myomesin family member 2
  • myomesin-2
  • titin-associated protein, 165 kD
  • TTNAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-86460
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF4779
Species: Hu
Applications: WB, IHC
NBP1-87496
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Myomesin 2 Antibody (NBP1-87496) (0)

There are no publications for Myomesin 2 Antibody (NBP1-87496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myomesin 2 Antibody (NBP1-87496) (0)

There are no reviews for Myomesin 2 Antibody (NBP1-87496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Myomesin 2 Antibody (NBP1-87496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myomesin 2 Products

Bioinformatics Tool for Myomesin 2 Antibody (NBP1-87496)

Discover related pathways, diseases and genes to Myomesin 2 Antibody (NBP1-87496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myomesin 2 Antibody (NBP1-87496)

Discover more about diseases related to Myomesin 2 Antibody (NBP1-87496).
 

Pathways for Myomesin 2 Antibody (NBP1-87496)

View related products by pathway.

Blogs on Myomesin 2

There are no specific blogs for Myomesin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myomesin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYOM2