PA1 Antibody

Images

 
Immunohistochemistry-Paraffin: PA1 Antibody [NBP1-89792] - Staining of human thyroid gland shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTGRDLFSLDSEDPSPASPPLRSSGSSLFPRQR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAGR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PA1 Protein (NBP1-89792PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PA1 Antibody

  • chromosome 16 open reading frame 53
  • FLJ22459
  • GAS
  • glutamate-rich coactivator interacting with SRC1/NCOA1
  • MGC4606
  • PA1
  • PAXIP1-associated protein 1
  • PTIP-associated 1 protein
  • PTIP-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF4715
Species: Mu
Applications: WB
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
AF2988
Species: Mu, Rt
Applications: WB
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF972
Species: Hu
Applications: WB, Simple Western, IHC

Publications for PA1 Antibody (NBP1-89792) (0)

There are no publications for PA1 Antibody (NBP1-89792).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA1 Antibody (NBP1-89792) (0)

There are no reviews for PA1 Antibody (NBP1-89792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for PA1 Antibody (NBP1-89792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PA1 Products

Bioinformatics Tool for PA1 Antibody (NBP1-89792)

Discover related pathways, diseases and genes to PA1 Antibody (NBP1-89792). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PA1

There are no specific blogs for PA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PAGR1